KEGG   Mus musculus (mouse): 545156
Entry
545156            CDS       T01002                                 

Gene name
Kalrn, 2210407G14Rik, AV235988, DUET, E530005C20Rik, Gm539, H, Hapip, TRAD
Definition
(RefSeq) kalirin, RhoGEF kinase
  KO
K15048  kalirin [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    545156 (Kalrn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    545156 (Kalrn)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    545156 (Kalrn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     545156 (Kalrn)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  Trio family [OT]
   545156 (Kalrn)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    545156 (Kalrn)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   545156 (Kalrn)
SSDB
Motif
Pfam: Spectrin RhoGEF CRAL_TRIO_2 PH CRAL_TRIO IQ_SEC7_PH PH_10 T4_Rnl2_C
Other DBs
NCBI-GeneID: 545156
NCBI-ProteinID: NP_001157740
MGI: 2685385
Ensembl: ENSMUSG00000061751
Vega: OTTMUSG00000017795
UniProt: A2CG49
Position
16; 16 B3
AA seq 1654 aa
MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEVLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPTE
ARDSAMSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIM
EVQASGIELICEKDLDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVK
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQA
GHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRD
EDWCGGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPS
VASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQET
GEYYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEI
RKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDREVKLRDANH
EINEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHII
FGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEH
AGTFFDEIQQRHGLANSISSYLIKPVQRVTKYQLLLKELLTCCEEGKGELKDGLEVMLSV
PKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSK
EIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQ
EWIKNIREVIQERIIHLKGALKEPIQLPKTPAKLRNNSKRDGVEDGDSQGDGSSQPDTIS
IASRTSQNTVESDKDGNLVPRWHLGPGDPFSTYV
NT seq 4965 nt   +upstreamnt  +downstreamnt
atgacggaccgcttctgggaccagtggtatctttggtatctccgcttgcttcggcttctg
gatcgaggatcttttcggaatgatggtttgaaagcttctgatgtccttcctatcctaaag
gagaaagtggcctttgtgtctggggggcgtgacaagcgaggtggacccatcctgaccttc
cctgcccgaagcaatcatgacagaataagacaggaagacctacggaaacttgtgacgtat
ttggccagcgtgccaagtgaggacgtttgcaaacgtggcttcaccgtcatcatcgacatg
cggggctccaagtgggatctcatcaagcccctcctcaagacgctgcaggaagccttcccc
gccgagatccatgtggccctcatcatcaagcctgacaacttctggcagaagcagaagacc
aactttggcagctccaaattcatctttgagacaagcatggtgtctgtggagggcctcacg
aagctggtggacccctcccagctgacagaggagtttgacggctccctggattacaaccat
gaggagtggattgagttgcgcctctccctggaggagttcttcaacagtgcggtccacctg
ctctcacgccttgaggacctgcaggagatgctggcccggaaggagttccctgtggatgtg
gagggctctcggaggcttatcgacgagcacacgcaacttaagaaaaaggtgctgaaggcc
cccgtggaagagctggaccgggaggggcagcgtctactgcagtgcatccgctgcagcgat
ggcttctcagggcgcaactgcatcccaggaagtgccgacttccagagccttgtacccaag
atcaccagcctcctggacaagctgcattccacccgacaacacctgcaccaaatgtggcac
gtgcgaaagctcaagctggatcagtgcttccagctgcggctcttcgagcaggatgctgag
aagatgttcgactggataagccacaacaaggagttatttcttcagagccacacagagatc
ggagtcagctaccagcatgcactagacctccagacacagcacaatcactttgccatgaac
tccatgaatgcctatgtcaacatcaaccgcatcatgtctgtcgcttcccgcctctcagag
gccggccattatgcctcccagcaaatcaagcagatctccacgcagctagaccaggagtgg
aagagctttgccgctgccctggatgaacgcagtacaatcctggccatgtctgctgtgttc
caccagaaggcagagcagttcctgtcaggcgtggatgcctggtgtaagatgtgcagcgaa
ggcggccttccttctgagatgcaggacctggagctggcaatccaccatcaccagtcctta
tatgagcaggtgacccaggcctacacagaggtcagccaggatggcaaagcactactggat
gtcctgcagcgtcccctgagtcctgggaactctgagtccctcacagccacagccaactac
tccaaggcggtccaccaggtgctggatgtggtccacgaggtgctgcaccatcagcgacgg
ctcgagagcatctggcagcaccgcaaggtgcggcttcaccagcggctgcagctgtgtgtc
ttccagcaggatgtgcagcaggtgctggactggattgaaaaccatggcgaggcctttctc
agcaaacacactggggttggcaagtccttgcatcgagcacgtgcactacagaagaggcat
gatgactttgaagaagtggcacagaatacatacaccaatgcggacaagctcctagaagca
gcggagcagctggctcagactggggaatgtgacccggaggagatctacaaggcagcccgg
cacctggaggtgcgcatccaagactttgtgcgcagagtggagcagcggaagctgcttctg
gacatgtcggtctctttccacacgcacaccaaagagctgtggacatggatggaggacctt
cagaaggaggtgctggaggatgtctgtgcagactctgtggatgcggtccaggagctgatc
aagcagttccagcagcagcagaccgccaccctggatgccactctcaatgtcatcaaggaa
ggcgaagaccttatccagcagctcaggtcagcgcctccctccctgggggagcccaccgag
gccagggactcagcgatgtccaacaacaagacaccccacagtagctctatcagccatatt
gagtctgtcctccagcagctggacgatgctcaggtacagatggaagagctgtttcacgag
cggaagatcaagctggacatcttcctacagctgcgcatctttgaacagtacaccattgag
gtcactgcagagctggatgcctggaacgaggacttgctccggcagatgaatgatttcaac
acagaggatctgaccctggctgagcagcggctacagcgccacacagaacggaagcttgcc
atgaacaacatgacgttcgaggtcatccagcagggccaggacctgcaccagtacatcatg
gaagtgcaagcgtcaggaatcgagttaatctgtgagaaggaccttgacctggcagctcag
gtgcaggagctgctggagtttctccatgagaagcagcacgagctggagctcaatgcggag
cagacgcacaagcggctagagcagtgtctccagctgaggcacctccaggctgaggtcaaa
caggttctgggatggatccgcaatggagagtcgatgctcaacgccagcctggtcaacgcc
agctctttgtcggaggcagagcagctgcagcgggagcatgaacagttccagctagccatc
gagaagacgcaccagagcgccctgcaggtacagcagaaggcagaggcactgctccaggcc
ggccactacgacgcagacgccatccgggaatgtgctgagaaggtggccctccactggcaa
cagctcatgctaaagatggaggaccggctgaagcttgtcaacgcctctgtggccttttac
aagacctctgagcaggtgtgcagtgttctggagagcttggagcaggagtaccggagagac
gaggactggtgtggtgggagagacaagctggggccggcggcagagatggaccacgttatt
ccactcctcagcaagcacctggagcagaaggaggccttcctgaaggcctgcacgctggca
aggcggaacgccgaggtgttcctcaaatacatccacaggaacaatgtgagcatgcctagt
gttgccagccacacccgggggcctgaacagcaagtaaaagccatcttgagcgagctcttg
cagagggagaatcgagtcctgcacttctggaccttgaagaagcggcggttagaccagtgt
cagcaatatgtggtgtttgagcgcagtgctaagcaggcactggactggatccaagaaaca
ggagaatattacctctcaacacatacctccaccggagagaccacggaggagactcaggag
ctgctgaaagagtatggagaattcagggtgcctgccaagcaaacgaaggagaaggtgaaa
cttctgatccagctagcagacagctttgtggaaaagggccacatccacgccacagagata
cggaaatgggtgaccacggtggacaagcactaccgcgatttctccctgaggatggggaag
taccggtactcgctggagaaggcgctgggggtcaacacggaggataacaaggacctagag
ctggacatcatcccagcaagcctttcggatcgggaggtcaagctccgggacgctaaccat
gagatcaatgaagagaaacggaagtcagctcgaaagaaagagttcattatggctgaactg
ctccaaactgagaaggcttatgtaagggacttgcacgagtgcttggagacctacctgtgg
gagatgactagtggtgtggaagagataccccccggcatcctcaataaggaacatatcatc
ttcggcaacatccaggagatctatgacttccataacaacatcttcctcaaagagctggag
aagtacgagcagctgcctgaggatgtgggacactgctttgttacctgggcagacaaattt
cagatgtatgtcacctactgtaaaaacaagcctgattccaaccagctgatcctggagcat
gcgggcaccttctttgatgagatccagcagcggcatggcctggccaactccatctcctcc
tacctaattaagcctgtccagagggttaccaagtaccagctgctcctgaaggaacttcta
acttgctgtgaagaagggaaaggagagctgaaggatggcctggaggtgatgctcagtgtc
cccaagaaagccaacgatgccatgcatgtcagcatgctggaagggttcgatgaaaacttg
gatgtacagggggagttgattctccaggatgcctttcaagtgtgggacccaaagtcgctg
atccggaaggggcgggagcgccatctgttcctctttgagatctccttggtgtttagcaaa
gagatcaaagactcttcaggacacacgaaatatgtttacaagaacaagctactgacctca
gagctgggtgtgaccgagcatgtagaaggtgacccctgcaaattcgccttgtggtctggg
cgcaccccatcctcagacaataaaacagtgctcaaagcttccaacatcgaaaccaagcag
gaatggatcaagaacattcgagaagtgattcaggagaggatcattcatcttaaaggcgct
ttaaaggagccaattcagctccccaaaacaccagccaaactgaggaacaatagtaagagg
gatggggtagaggatggtgacagccaaggggatgggagcagccagccagataccatatcc
attgcctccaggacctctcagaacacagtggaaagtgacaaggatggcaaccttgttcct
cgttggcacctgggacctggagatcctttctccacttacgtttag

DBGET integrated database retrieval system