KEGG   Mus musculus (mouse): 545370
Entry
545370            CDS       T01002                                 

Gene name
Hmcn1, EG545370, FIBL-6, Gm201
Definition
(RefSeq) hemicentin 1
  KO
K17341  hemicentin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    545370 (Hmcn1)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set C2-set_2 Ig_6 Ig_5 EGF_CA TSP_1 Ig_4 G2F cEGF TSP1_spondin FXa_inhibition EGF_3 TSP1_ADAMTS TSP1_CCN
Other DBs
NCBI-GeneID: 545370
NCBI-ProteinID: NP_001019891
MGI: 2685047
Ensembl: ENSMUSG00000066842
Vega: OTTMUSG00000021664
UniProt: D3YXG0
Position
1; 1 G1
AA seq 5634 aa
MIAQEVVHTVFLVALFRSSLAGDGTPQSESRAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLYNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLTGDCDDRNH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEHAVNTWKIPF
DPSLKEVTVSLSGPSPVIEIRNPFGKLIKKGFGLNELLNIHNSAKVVNVKEPEAGMWTVK
TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTMSRPVQGIPTYVLLNTSGISSPARVD
RLELLSISGGSLKTIPVKHYPDRKPYGIWNISDFIPPDEAFFLKVTGYDKDGYLFQRVSS
VSFSSIVPDAPKVTMPTRTLGYYLQPGQILCSVESFLPFTLSFMRDGIALGVDQYLRESA
SVNWDFTKVTLSDEGFYDCIAVSSAGTGRAQTFFDVSEPPPIIQLPNNVTVTPGERAVLA
CLVISAVDYNLTWQRSGRDIRLADSARIRTLANLSLELRSVKIGDAGEYRCVVSSEGGSA
AASVFLTVQEKPKVTVMPKNQSFTGGSEISIMCSATGYPKPKIVWTMNEMFIMGSHRYRM
TSEGTLFIKNAVPKDAGTYACLASNAAGTDKQTSTLRYIEAPKLVVEQSELLVALGDTTV
MECKTSGIPPPQVKWFKGDLELRPSTFLSIDPLVGLLKIQETQDLDAGDYTCVAINEAGR
ATGRLTLDVGSPPVFIQEPSDVAVEIGSNVTLPCYVQGYPEPKIKWRRLDNMPVFSRPFS
VSFISQLRTGALFISNLWASDKGTYICEAENQFGKIQSQTTVTVTGLVAPLIGISPSMAS
VIEGQPLTLPCTLLAGNPIPERRWMKNSAMLVQNPYITVRSDGSLHIERVRLQDGGKYTC
VASNVAGTNNKTTSVAVHVLPSIQHGQQILSTIEGVPVTLPCRASGIPKPSITWSKKGEL
ISTSSAKFSAGADGSLYVVSPGSEESGEYICTATNAAGYAKRKVQLTVYVRPRVFGDQRG
LSQDKPVEISVLAGEEAILPCEAKSLPPPIITWAKDSQLISPFSPRHTFLPSGSMKITET
RVSDSGMYLCVATNIAGNVTQSVKLSVHVPPKIQHGNRHIKVQVGQRVDILCNAHGSPPP
VITWFKSGRPFLDGAQHPGSPDGTLSIEQAVISDAGVYTCAATNIAGSDEAEVTLHVQEP
PSVEDLQPPFNTPFQERLANQRIEFPCPAKGTPKPTIKWLHNGREVTGQEPGVSILEDGA
LLVIASVTPHNNGEYICVAVNEAGTTERKYNLKVHVPPVIRDKEHVTNVSVLTSQLASLY
CEVEGTPSPVITWYKDDIQVTESSTVQIVNNGKILKLFKVSAEDAGRYSCKAINIAGTSQ
KDFSVNVLVPPSILGASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWFKDGKPLFLGDPNI
ELSDRGQSLHLRNARRSDKGRYQCTVSNAAGKQAKDIKLTVYVPPSIKGGNITTEISALL
NSIVKLECETRGLPVPAITWYKDGQVVTSSSQALYIDKGQLLHIQRAQVSDSATYTCHAA
NVAGTAEKSFHVDIYVPPTIEGDLTAPSNKQVIIGQSLILECKAAGNPPPILTWLKDGVP
VKASDNIHIEAGGKKLEILSALEVDRGQYICVATSVAGEREIKYEVDVLVPPAVEGGEET
SYFIVLANNLLELDCQVSGSPPPTIMWLKGGQLIDERDGFKILLNGRKLVIAQAQVSDTG
LYQCVATNIAGDHRKEFEVTVHVPPTIKSSDLPEKTVVRYKPVTLQCIANGIPNPSITWL
KDDQPVNTAHGNLKIQSSGRVLQIAKALLEDAGRYTCVATNAAGEAHQHTQLHVHEPPSL
DDAGKMRNETVVVNNPIQLECKATGKPLPVITWYKDSHPLSGSASAAFLKRGQVLEIGSA
QISDAGIYKCVAINSAGATELFYSLQVHVPPSISGSSSMVEVVVNNLARLECEARGIPAP
SLTWLKDGSPVSSFSNGIQILSGGRILALTSAQMSDAGRYTCVAVNAAGEKQRDIDLRVY
APPNIMGEEQNVSVLIGQAVELFCQSDAVPPPTLMWLKDGRPLLKRPGLSISENGSVLKI
EDAQAGDTGRYTCEATNVAGKTEKNYNVNVWVPPSIYGSDELVQLTAIEGNLITLLCESS
GIPPPDLTWKKKGSLVLADSAGRVHILSGGRRLQISIAEKADAGLYTCVASNVAGVAKKE
YNLQVYIRPSITNSGGHRPEITVIRGKSISLECEVQGIPQPTVTWMKDGRPLTKGKGVEI
LDEGRILQLKNVHVSDTGRYVCVAVNVAGMTDKRYDLSVHAPPSIIGNHGVPENVSVVEK
SSVSLTCEASGIPLPSITWLKDGWPVNLGSSVKILSGGRMLRLMQTRPEDAGQYTCIVRN
AAGEDRKMFGLSVLVPPHIVGENTLEDVKIKEKQSVTLTCEVRGNPVPQITWHKDGQLLQ
EDEAHHMMSGGRFLQITNAQVSHTGRYTCLASNIAGDKSKSFRLNVFVSPTIAGVDSDGS
PEDVIVILNSPTSLVCEAYSYPPATITWFKDGTPLESNRNIRILPGGRTLQILNAQEDNA
GRYSCVATNEAGEKIKHYEVKVYIPPIIKKGDLLGPGLSPKEVKIRVNSSLTLECEAYAI
PSASLRWYKDGQPLKSDDHVTIAASGHTLQIKEAQISDTGRYTCVASNLAGEDELDFDVN
IQVPPSFQKLWEIGNMLDTGRSGEAKDVIINNPLSLHCETNAAPPPTLTWYKDGRPLTSS
DRVLILPGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLRYDVHVLLPPVIKGANSDLPEE
VTVLVNKSTQMECSSSGNPAPRNYWQKDGQILLEDEHHKFQSDGRSLQILNAQITDTGRY
VCVAENTAGSAKKYFNLNVHVPPSVIGPNHEHLSVVVNHFISLNCEVSGFPPPDLSWLKN
EEPIKPNTNVLTVPGGRTLQIIRAKISDGGDYTCIAINQAGESKKKVSLTVHVPPSIKDH
GSQSLSIVNVREGTSVSLECESNAVPPPVITWSKNGRMIPDSTNVEILTGGQTLHIRRAE
VSDTGQYVCRAINVAGRDDKNFHLNVYVPPTIEGPETEVIVETISNPVTLTCDATGIPPP
TITWLKNHKPIENSDPLEVHILSGGSKLQIARPQRSNSGNYTCVASNMEGKAQKNFILFI
QVPPSVAGAEVPSEVSVLLGENVELVCNADGIPTPHLQWLRDGKPIVNGETERVRVTTDG
STLNIYRALTSDMGKYTCVATNPAGEEDRIFNLNVYVPPKIRGNKEEAEKLMALVDTSIN
IECKATGTPPPQINWLKNGLPLPISSHIRLLSAGQVVRIVRAQVSDIAVYTCVASNRAGV
DSKHYSLQVFVPPNMDNAMGTEEITIVKGSSTSMTCFTDGTPAPSMSWLRDGQPLAPDAH
LTVSTQGMVLQLIKAETEDTGKYTCVATNEAGEVSKHFVLKVLEPPHINGSEGPGEVSVI
VNNPLELSCIASGIPAPKISWMKDGRPFLQTEQVQTLEGGAILRVSSAQVEDTGRYTCLA
SSPAGDDDKEYLVRVHVPPNIAGMDEAQDFTVLRNRQVTLECKSDAVPPPVIMWLKNREQ
LQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFNLTVNVPPSIGGGPQS
LVTLLNKSIALECRAEGVPAPRITWRKDGVVLAESHARYSILENGFLHIESAHVTDTGRY
LCMATNVAGTDRRRIDLQVHVPPSIAMGPTNVTVTVNVQTTLACEATGIPKPSVTWRKNG
HLLNVDQNQNSYRLLSSGSLVIISPSVDDTASYECTVTSDAGEDKRAVDLTVQVPPTIAD
EPMDFLVTRQAPAVMTCSASGVPVPSIHWTKNGLRLLPRGDGYRILSSGAIEIPTTQLNH
AGRYTCVARNAAGSAHRHVTLRVQEPPVIQPQPSELDVILNNPILLPCEATGIPTPFITW
QKEGINVITSGKSLAILPSGSLQISRAVRGDAGTYMCVAQNPAGTALGKVKLNVQVPPVI
SSHQKEYVVTMDKPVSLLCETEGSPPPDITWHKDGHALTESIRQRILNSGALQIAFAQPD
DAGQYTCMAANMAGSSSVSSTLTVHVPPRIQSTEVHFTVNENSQAVLPCVADGIPTPAIH
WEKDGVLIANLLGKYTAQPYGELILENVVLEDSGTYTCVANNAAGEDTRIVTLAVHTLPT
FTELPGDLSLNKGEQLRLSCKAVGIPLPKLTWTFNNNIIPAHFDSINGHSELVIEKVSKE
DSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPAPTI
QWSRKGADIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVAANEAGMVERSMSLTLQSSPI
ITLEPVETVVDAGGRVILDCQAAGEPQPTITWSRQGQPISWDNRLSMLPNSSLYIAAARK
EDTSEYECVARNLMGSVLVRVPVIVQVHGGFSLWSAWRPCSVTCGKGIQKRSRLCDNPPP
ANGGRPCQGADSEARHCHNKLCPVDGHWSEWSFWEDCSRSCGHGNQTRTRTCSNPPAQHG
GRPCEGHAVETIMCNIRPCPVHGVWNAWQPWSACSKSCGKGSQTRMRLCNNPPPSFGGAH
CSGAETQMQVCNERHCPVDGRWATWSSWSACTVSCGGGARKRTRDCSDPVPQYGGNKCEG
TGVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPRPSNGGRACGGPDT
QIQRCNTDMCPVDGSWGTWHSWSHCSVSCGGGERTRKRLCDNPVPTKGGRSCPGDATQVS
RCNMQACPGGPQRARGSVIGNINDIEFGIAFLNATITDSPNTDTRVIQAKITNVPRSLGP
AMRKIISILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFATGEVLRMTHVARGLDSD
GALLLDVIVSGQVLQLHSPAEVGVKDYTEDYIQTGPGQLYAYSTRLFTIDGISIPYTWNH
TIFYDQAWGKMPFLVETLHASSIESDYNQLEETLGFKIHASISKGDRSNQCPSGFILDSV
GPFCADEDECTAGNPCSHTCHNAIGAYYCSCPKGLTIAADGRTCQDIDECALGGHTCRAG
QDCDNTIGSYRCVVHCGTGFRRTSDGLSCQDINECQESSPCHQRCFNVIGSFHCGCEAGY
QLKGRKCIDVNECRQNVCRPDQHCKNTRGGYKCIDLCPSGMTKAENGTCIDIDECKDGTH
QCRYNQICENTRGSYRCACPRGYRSQGVGRPCIDINECEQVPKPCAHQCSNSPGSFKCIC
LPGQQLLGDGKSCAGLERLSNYGTQYSSYTLERFSPVRSDYQPSQHYRQYSQLYSSYSEY
RNSRASFSRNRRTIRKTCPEGSEANHETCVDIDECQNRDTCQHECKNTIGSYQCVCPPGY
RLMLNGKTCQDVDECLEQNVRCGPNRMCFNMRGSYQCIDTPCPPNYQRDPVLGFCLKNCP
PNDLECTLSPYALEYKLVSLPFGIAANQDLIRLVAYTQDGVMHPRTTFLMIDEEPAVPFA
LRDENLKGVVYTTRPLREAETYRMKVGALSYSANGTIEYQTTFIVYIAVSAYPY
NT seq 16905 nt   +upstreamnt  +downstreamnt
atgattgcccaggaagtggtccacacagtattcctggtggctctttttcgttcttcccta
gctggagatgggactccgcagtctgagagcagggctgaggagattcctgagggggcgtcc
acgctggcttttgtgtttgatgtgactgggtccatgtatgatgatttagttcaggttatt
gaaggggcttccaaaattttggagacgtctttgaaaagacctaagagacctctttacaac
tttgctttggtgcccttccatgatccagaaattggtccagtgacaattaccacagatcca
aaaaaatttcagtatgaattgagagaactgtatgttcagggaggtggtgactgtccagaa
atgagcatcggggctataaagattgccttggaaatctctcttcctgggtccttcatctat
gttttcactgatgcacgatccaaggattatcggctcacccatgaggtgctgcagcttatc
caacagaaacaatctcaggtggtatttgtgctcactggagactgtgatgacaggaatcat
attggatataaagtctatgaagaaattgcctctacaagttctggtcaagtgttccatctg
gacaaaaagcaagtgaatgaggtgttgaagtgggtggaagaagctgtgcaggcctccaag
gttcacctcttatccaccgatcatttggagcacgctgtgaatacttggaaaattcctttt
gatcccagcctcaaagaagttactgtgtccctgagtggcccgtctcccgtgattgagatt
cgcaatcctttcgggaagctgataaaaaagggatttggcctgaatgagctgttaaatatc
cataactctgccaaagtggtgaatgtcaaagagcctgaagctggcatgtggacagtgaag
acctccagcagtggaaggcattctgttcgtatcaccggtctcagcactattgatttccga
gctggcttttctcgaaagcccacgctggacttcaaaaaaacaatgagcagacccgtgcaa
ggaatacctacgtatgtgctactgaacacttctggaatctccagtccagctagagtagac
cgtctcgaacttctgagtatctcagggggatctcttaagaccattcctgttaagcattac
ccagatcggaagccttacggcatctggaatatttctgacttcattcccccagatgaagct
ttctttctcaaggtgacaggctatgacaaagatggttatctcttccagagagtgtcaagt
gtttctttttccagcattgtcccagatgctcccaaagttacaatgcccacaagaacgctg
ggatactacctgcagccaggccaaatcctctgttcggttgagagttttttgccctttact
ttgagtttcatgagagatggaattgccctgggagtagaccaatatttaagagaatctgcc
agcgtgaactgggacttcacaaaggtgacgttgtctgacgagggcttctatgactgtatc
gctgtgagcagcgcagggacgggacgggcacagacgttctttgatgtatcagagcctcct
ccgatcatccaactgcctaataatgtaacagtcactcctggagaaagagcagttttggca
tgtcttgtcatcagtgccgtggattataacctaacctggcagaggagtggcagagatatc
cgactagcagactcagcaagaattaggaccttggccaacctctcactggagctgaggagt
gtgaaaattggtgatgctggggagtaccgttgtgtggtttccagtgaagggggatcagca
gcagcttcagttttcctcacagtccaagaaaaacccaaagtcactgtgatgcccaagaat
cagtctttcacaggagggtctgagatctccatcatgtgttctgcaacaggatatcccaaa
ccgaagattgtctggaccatgaatgagatgtttatcatgggttcacacaggtacaggatg
acctcagaaggtaccttattcatcaagaatgcagttcctaaagatgcagggacctacgct
tgcctggcaagcaatgcagctggaacagataagcaaacatccactctcagatacatagaa
gccccaaagttggtggtagagcagagtgagctcttggtggcccttggggatacaacagtt
atggaatgtaaaacttctgggattcctccacctcaagtaaagtggttcaaaggagatctc
gagttgaggccctcaacattcctcagtattgaccctctcgtgggacttttgaagattcaa
gaaacacaagatctggatgctggtgactatacctgtgtagccatcaatgaagcaggaaga
gcaacaggcagactaactctggatgtaggctcacctccggttttcatacaagaaccttct
gatgtggccgtggaaattggctccaatgtgacattgccttgttatgttcagggttatcca
gaaccaaagatcaaatggcgtaggctggacaacatgccagttttctcaagacccttttca
gttagtttcatcagccagctgagaacaggagctctctttatttcaaatttatgggcaagt
gataaaggaacgtacatctgtgaagctgagaaccagtttggaaaaatacagtcgcagaca
acagtaacggtgacaggactcgttgccccacttattggaatcagcccttccatggccagc
gttattgaaggacagcctctaactctgccttgtactctgttggctggaaatcccattcca
gaacggcggtggatgaagaactcagccatgttggtacaaaatccctacataactgtgcgc
agcgatgggagcctccatattgaaagagttcgacttcaggatggaggcaaatacacttgt
gtggccagtaatgtcgctggaaccaataacaaaacaacctctgtggccgtgcatgttctg
ccaagcattcagcacggccagcagatactgagcacaattgaaggcgttccagtaactcta
ccctgcagagcgagtgggattcccaagccatctatcacctggtcaaagaaaggagagctg
atttcaacgagcagtgccaagttttctgcaggggctgatgggagtctgtatgtggtgtca
ccagggagtgaggagagtggcgagtacatctgtacagccaccaatgcagccggctatgcc
aagaggaaagtgcagctgactgtctatgtaagacccagagtgtttggggaccaaagagga
ctgtcccaagataagcctgtggagatctctgtcctggctggggaggaggcaatacttccc
tgtgaagctaagagcttacctccacccatcattacctgggccaaagatagccaactcatc
tctccattttctccaagacacacgttcctcccttctggctcaatgaagatcacagagacc
cgcgtttcagacagtgggatgtatctgtgtgttgccacaaatattgctgggaatgtgact
cagtccgttaaattaagtgtccacgttcctccaaaaatacagcatggaaatcgacacata
aaagtccaagtcggccagagagtggacatcctatgcaatgcccacgggtctccgcctccc
gtgatcacctggtttaaaagcggaaggccgttccttgatggagcgcagcatcctggtagc
ccagacggaacgctgagcattgagcaggctgtgatctcagatgctggcgtatatacatgt
gctgccacgaacatagccggaagtgatgaagcagaggtcacattgcatgtccaagaacca
ccttcagtggaagacctgcaacctccttttaacactccgttccaagaaaggttggccaat
cagcgcatcgaatttccatgccctgcaaaaggtactcctaaaccaaccatcaagtggtta
cacaatggcagagaggtgacagggcaagagcctggtgtttctatcttggaagatggcgca
ctgttggtaatcgcttctgttacaccacacaacaatggcgagtacatctgtgtggccgtc
aatgaagctgggaccacagaaaggaaatacaacctcaaagttcatgttccaccagtaatt
agagataaggaacatgtgaccaatgtgtccgtgttgacaagccaactggccagcctctac
tgtgaagtagaaggaactccgtcccctgtcataacatggtataaggacgacatccaggtg
acagaaagcagcactgttcagattgtgaacaatggaaagattctaaaactctttaaggtg
tctgccgaggatgcgggaagatattcctgcaaagcaattaatattgcaggcacctctcag
aaggactttagtgtcaatgtactagttccacccagcatactaggtgccagctccccgagt
gaagtctcagttgttcttaaccacaacgtcaccctgcagtgtcctggcacaggcgtcccc
tttccggctattcactggttcaaggatggcaagcctttatttttgggagatcctaacatt
gaactctcagacagaggacagagtttacatctgagaaatgcacggagaagtgacaaggga
cgctaccaatgtactgtgtccaatgcagcaggcaagcaagccaaggatataaaactcact
gtctatgttccacctagtattaaaggaggcaatattaccacagaaatatcagcgttgctc
aacagtatagttaaactggaatgtgagacacgggggctcccagtgcctgccattacttgg
tataaggatggccaggtagtcacatccagctcacaagcactttatattgacaaaggacaa
cttctccacattcagagagcacaggtctctgactcagcaacatacacatgtcatgcagcc
aacgttgctggaacggctgagaaatcattccatgttgacatctatgttcctccaacaatc
gaaggtgacttgaccgctccttcaaataagcaagtcattattggtcagtcgttgatcttg
gagtgtaaagctgctggcaaccctcctcccattctcacttggttaaaagatggcgtgcct
gtgaaagccagtgacaacatccacatcgaagccggtgggaagaagctcgaaatcttgagt
gccctagaagttgatcggggacagtacatatgtgtagctaccagtgtggcaggagaacgg
gaaatcaagtatgaagttgatgtcttggtgccaccggctgtggaaggaggagaggaaaca
tcttacttcattgtgttggcaaataacttactggagctagactgtcaggtctcaggctct
cccccaccaactatcatgtggctaaaaggtggtcagttaattgatgagagagatggattc
aagatcttactaaatggacgcaaactcgttattgctcaggctcaagtgtcagacacaggc
ctttaccagtgtgtggcaacaaacattgcaggggaccacaggaaggagtttgaagtgacc
gttcatgttcctccaacaatcaagtcctcagaccttcctgagaagactgtggtgagatac
aagccagttaccttgcagtgcatagccaatggcattccaaatccatccattacatggctg
aaggatgaccagcctgtgaacactgcccatgggaacctcaaaatacagtcttctggtaga
gttctacaaattgccaaggctcttttggaagatgctggtagatacacatgtgtggctacc
aatgcagctggagaagcacaccagcacactcaactgcatgtgcatgaacccccaagcctg
gatgacgcgggaaagatgcggaatgagacagtggtggtgaataaccccatacagctggaa
tgtaaagccacaggcaagcctcttcctgttatcacgtggtacaaagacagccatcccctc
tcaggctctgcaagtgcagccttcctgaagagaggccaggtccttgagattgggagtgct
cagatctcagatgctggcatctacaaatgtgtagccatcaactctgctggagctacagaa
ctgttttacagcctacaagttcatgtgcctccttcgatctcaggtagcagttccatggtg
gaggtggtggtgaataatctagcaaggttagaatgtgaagccagaggcatccctgccccg
agtctgacctggctgaaagatgggagcccagtctctagcttctctaatggaatacagatt
ctctcgggaggtcgcatcttggcactgaccagtgctcagatgagtgacgcaggaaggtac
acctgcgtggcagtgaacgctgctggggagaaacaaagggacattgacctcagagtctat
gctccacccaatattatgggagaagaacagaatgtctccgtcctcattggccaagctgtg
gagttgttttgtcaaagtgatgctgttcctccccctactctgatgtggttgaaggatggc
cgccctctgctgaagagaccaggtctcagtatctctgaaaacggaagtgtgcttaagatt
gaagatgctcaggccggagacactggtcgttacacctgtgaagccaccaatgttgctggg
aaaacggagaagaactacaacgttaacgtctgggtaccacctagtatttatggctctgat
gagcttgtgcaacttacagccattgaagggaatcttatcactctcctatgtgaatcaagt
ggaatcccacccccagatcttacctggaagaagaaaggttctctggtgttggctgactct
gcaggacgtgttcacattttatctggtggcagacgactacaaatttcgattgctgagaaa
gcagatgcaggactctacacatgtgtggcgtccaatgtggctggagttgcaaagaaagag
tataacctgcaagtgtatatccgaccatcaataaccaacagtggtggccaccgccctgag
attactgtcatccgtgggaaaagtatttctttggaatgtgaggtgcagggtattcctcag
ccaacagtgacctggatgaaagatggccgccccttgaccaagggaaaaggagtggaaata
ttggatgaaggccgaatccttcagctgaagaatgttcatgtgtctgacaccggccgttat
gtgtgtgttgctgtgaatgtagcaggaatgactgacaagagatacgacttaagtgttcat
gcccctccaagcatcatcgggaaccacggagtccctgagaacgtcagtgtggtggaaaag
agttctgtatccctgacctgtgaagcctccggcatccccctgccttccataacctggcta
aaggatggctggcctgtcaaccttggcagttctgtgaaaattctctcaggaggcaggatg
ctgcggttgatgcagaccagaccagaagatgctggccaatatacttgtattgtaaggaat
gcagctggtgaagacaggaaaatgtttggactttcagtattagttcctcctcacattgtg
ggtgagaacacattggaagatgtaaagattaaagagaaacagagtgttaccttgacttgt
gaagtgagagggaatcctgtgccacagatcacgtggcacaaagacggacagcttctccaa
gaagatgaagcccaccacatgatgtctggtggccgttttcttcagatcaccaatgctcaa
gtgtcacacacaggacgatatacatgtctggcctctaatatagctggtgacaaaagcaaa
agcttccgtctcaacgtgtttgtatctcctacaattgctggtgtagacagtgatggcagc
cctgaagatgtcattgtcatccttaacagtcccacttccttagtctgtgaggcatattcc
tacccccctgctaccatcacctggttcaaggacggcacacctttagaatccaaccgaaac
attcgcattcttccaggaggccgtactctgcagatcctaaacgcgcaggaagacaatgct
ggacggtactcatgcgtggccactaacgaggccggggagaagataaagcactatgaagtg
aaggtctacattccacccataatcaagaaaggggacctcttggggccaggtctttcccct
aaggaagtgaagatcagagtgaatagcagcctgacactggagtgtgaagcttacgccatt
ccttctgcctccctccgctggtacaaggacggacagccccttaaatcggatgatcatgtt
accatcgccgcaagtggacatactcttcaaataaaggaagctcaaatctcagacactgga
cgatatacctgtgtggcatctaaccttgcaggcgaagatgagttggattttgatgtgaat
atacaagttcctccaagttttcagaaactctgggaaataggaaacatgttagataccggc
aggagcggtgaagctaaagacgtgatcatcaacaaccccctttctctgcactgtgagaca
aatgctgctcctccaccaactctgacatggtacaaagatggccgacctctgacctccagt
gaccgagtattgattttaccaggaggacgggtgctgcagattccccgggctaaggtagaa
gatgccgggagatacacatgtgtggctgtgaatgaagctggggaagactcccttcggtat
gacgtccatgtgctcttgccaccagttatcaagggagcaaacagtgatctgccagaagag
gtcaccgtgctagtgaacaagagtacacagatggaatgttcatccagtggtaacccagca
ccgagaaattactggcaaaaagatggacagatcttgttagaagatgaacatcataagttc
cagtctgatggcaggagtcttcagattctaaatgctcaaataacagatactggaaggtat
gtgtgtgtcgcagagaacactgctgggagtgccaagaaatactttaacctcaacgttcat
gttcctccaagtgtcattggtcctaaccatgaacatctctctgtggttgtgaaccatttc
atctctttgaactgtgaagtttctggttttccccctcctgacctcagctggctcaagaat
gaagagccaatcaagccaaacacgaatgttctcaccgtgcctggtggtagaactctacag
attatccgggccaagatatcagatggaggcgactatacctgcattgctatcaaccaagct
ggagaaagcaagaaaaaagtttcactgactgttcatgtgcccccaagcatcaaggatcac
ggcagccaatctctttctatagtgaatgtaagagaggggacctcagtgtctttggaatgt
gagtcaaatgctgtgcctcctccagtcatcacctggtctaagaatgggcggatgatacca
gattctaccaacgtggagattttaactggtggacaaacactacacatcagacgagccgag
gtgtctgacacaggccagtatgtatgtagagctataaatgtagcaggacgagatgataaa
aatttccacctcaatgtatatgtgcctcctactattgaagggccggaaacagaagtcatt
gtggagacaatcagcaatccagtgacattgacttgtgatgccactgggatcccgcctccc
accataacatggttaaagaaccacaagcctatagaaaattctgacccccttgaagttcac
attttgtctggaggaagcaaactgcagatcgcccgacctcagcgttcaaacagtggaaac
tacacgtgtgttgcatccaatatggagggaaaggctcagaaaaactttatccttttcatt
caggtccctccaagtgttgccggtgctgaagttccaagtgaagttagtgtccttctcggg
gaaaatgttgagctggtctgcaatgcagatggcattcccacccctcatcttcagtggctt
agggatggaaaacccatagtgaatggcgaaacagagcgagtcagggtcaccacagatggc
agcacattaaacatttacagagccctcacatctgacatggggaagtatacatgtgtggct
acgaatcccgctggagaagaagatcgaatatttaacttgaatgtctatgttccacctaaa
atccgaggtaataaagaagaggcagagaagctgatggctctggtagacacatcaataaat
attgaatgcaaagccactgggacgcccccaccgcagatcaactggctgaagaacggcctt
cctctacccatctcttcccacattcgcttgctgtcagcggggcaggttgtcaggatcgtg
agagctcaggtgtctgatatcgctgtatatacttgtgtggcctccaatagagctggggta
gacagtaagcactacagccttcaagtctttgtgccaccgaatatggacaacgcaatggga
acagaggaaatcacgattgtcaaaggcagttctacctctatgacgtgctttacagatgga
accccagctcctagcatgtcttggctcagagatggccagcctctggcgcctgatgctcat
ctgactgtcagcactcagggaatggtccttcagctcatcaaggcagaaacggaagatact
ggaaagtacacctgtgttgccacaaatgaagctggagaagtcagcaagcattttgtcctg
aaagtcctagagccacctcacattaacggatctgaaggacctggagaggtatctgtaatt
gtaaataacccacttgaattatcctgcattgcttctggaattcctgcccctaaaatttcc
tggatgaaagatggccggccctttctacagacagagcaagtgcagactctagaaggagga
gctattcttcgagtgtccagtgcacaggtggaggatacaggaagatacacctgcctggca
tccagtcctgcaggggatgatgataaagaatatttagtgagagtacacgtgcctcctaat
attgctggcatggatgaagcccaggacttcactgtgttaaggaacaggcaggtgacactg
gaatgcaaatccgatgcggtgcctccacctgtgatcatgtggctcaaaaacagggagcag
ttacaggcaacacctcgagtaagaatcctgtctgggggcagatacttacaaatcaataat
gcagacctgggagacacagccaattacacctgtgttgccagcaacatcgcgggaaagact
acaagagaatttaacctcactgtaaatgttcctccaagcatcggtggcggtccccagagc
cttgtcactctcttaaataagtcaatcgccctggaatgccgtgctgaaggcgtgccagca
ccgaggataacgtggagaaaggatggcgttgtgctagctgagagccatgcaagatattcc
atcttggaaaatggattccttcatattgaatcagcacatgtcacagatactggacggtat
ttgtgtatggcgaccaatgtggctggaacagaccgtaggcgaatagatttacaagtccat
gtccctccatcgattgctatgggtcctaccaacgtaacagtaacagtgaatgtccaaact
actttggcttgtgaagctactgggataccaaaaccatcagtcacctggagaaaaaatgga
catcttcttaatgtagatcaaaatcaaaattcatacaggctcctttcctctggttcactt
gtaatcatttccccctctgtggatgacactgccagttacgagtgcactgtgacaagcgat
gctggagaggacaagagagcagtggacctcactgtccaagttcctcccaccatagcggat
gaacctatggatttcctggtgaccagacaggccccagcagtcatgacctgctcagcttct
ggagttcctgttccctcaattcactggaccaaaaatggcctaagactgcttcccagagga
gacggctatcggattctgtcttcaggtgcaattgagatacctactacccaattaaaccac
gcaggaagatacacgtgtgttgctcgtaatgcagcgggctcagcacaccggcatgtaacc
cttcgtgttcaagagcctccagtcattcagccccaaccaagtgaactggatgtcattcta
aacaacccaatcttactaccatgtgaagcaacaggaatacctactccattcataacttgg
caaaaggaaggcatcaatgtcattacctcaggcaagagcctcgccattcttcctagtggc
agcttacagatctccagagctgttcgaggggatgcaggcacttacatgtgtgtggcccag
aacccagctggtacagccttgggcaaggtcaagctgaatgtgcaagttcctccagtcatt
agttctcatcaaaaggagtatgttgttacaatggataaacctgtctctctactgtgtgag
acagagggctctccaccacctgacattacctggcataaagatgggcatgcacttaccgaa
tctatccgccagcgcatcctgaattcaggggctctgcagatagcatttgctcagcctgat
gatgctggtcagtacacatgcatggctgccaacatggccggatcaagcagcgtcagcagc
acactcaccgtccatgtaccacctaggattcaaagcacagaagtacacttcaccgtcaac
gagaactcccaagctgttctcccgtgcgttgctgatggaatccccacgcctgcaattcac
tgggaaaaagatggtgttcttatagccaacttgttagggaaatacactgcccagccatat
ggagagctcatcttggaaaatgttgtgctggaagattctggcacctacacatgtgtcgct
aacaatgctgctggtgaagatacacgtattgtgaccctggctgtgcatacccttcccact
tttactgaacttcctggagacctgtcattaaataaaggagaacagctacggttaagttgt
aaagccgttggcatcccattgcccaaactaacgtggaccttcaacaacaatattattcca
gcccactttgacagcatcaatggacacagtgaactcgttattgaaaaggtgtcaaaggag
gactcgggcacttacgtgtgcaccgcggagaacagtgttggctttgtgaaagcgatcgga
tttgtttatgtgaaagagcccccagtcttcaaaggtgattacccatctaactggattgaa
ccactcggagggaacgcaatcctaaactgtgaggtaaaaggagaccctgccccaaccatc
caatggagccgcaagggggctgacatagagattagccacaggatccgacaactgggtaat
ggttccttggccatctacggcactgtgaatgaagatgctggtgactatacctgtgtagct
gccaatgaggccgggatggtggagcgcagcatgagcctgactctgcaaagttctcctatt
atcactcttgagccagtggaaactgttgtagatgctggtggcagagtcatactggattgc
caagcagctggtgaaccgcagccaaccatcacatggtcccgccaagggcaacccatctcc
tgggataaccgactttccatgctgcctaacagctcattatacatcgctgctgctcgtaag
gaagatacttctgaatatgaatgcgttgcccgaaacttgatgggctctgtcctggtcaga
gtgcctgtcatagtccaggtgcacggtgggttttcattgtggtctgcctggaggccctgc
agtgtcacctgtggaaaaggcatccaaaagaggagccggctgtgcgacaacccacctcca
gccaatggagggaggccatgccaaggggcggattcagaagcgcgacactgtcacaataag
ctgtgtccagtggatggtcactggtcagaatggagtttctgggaagactgctcaagaagc
tgtgggcatggcaaccaaactaggacgagaacttgcagcaacccgccggctcagcatggc
gggcggccatgcgaggggcatgctgtggaaaccattatgtgtaacatcaggccttgccca
gtccatggtgtgtggaatgcttggcagccttggagtgcgtgcagcaaaagctgtggaaaa
ggcagtcagaccagaatgagactttgcaacaacccgccaccgtcatttggtggggcccac
tgcagtggagcagaaacccagatgcaagtctgcaatgagagacactgtccagtggatggc
aggtgggcgacttggagcagttggagtgcctgcaccgtatcctgcggaggaggtgccagg
aagagaacaagggactgttctgacccagtgccacagtatggaggaaacaaatgtgaaggg
actggtgtccagagtgacttttgcaatagtgacccttgtccaacccatggtaactggagc
ccttggagcggctgggggacgtgcagtcggacatgcaatggagggcagatgaggcggtac
cgcacatgtgataatccacgtccctccaatggaggaagagcctgtgggggtccagatacc
cagatccagaggtgcaacactgacatgtgtcctgtggacggaagttggggaacatggcac
agctggagccactgttctgtctcttgtggaggaggtgaaaggactcgaaagcgactatgt
gacaatccagtgccaactaaaggtggccgttcctgtccgggagatgccacccaggtctcc
agatgtaacatgcaagcatgtccaggtggaccccagcgagccagaggaagtgttattgga
aatattaatgatattgagtttggaatcgctttcctaaatgccacaataacagatagccct
aacactgatacaagagtaatacaggccaagattaccaatgtgcctcgcagtcttggtcca
gcaatgagaaagatcatttctatcctaaatcccatttactggaccacagcaaaggaaata
ggggaagcagttaatggctttaccctcactaacgcagtcttcaaaagagagacgcaagtg
gaatttgcaactggagaggtcttgcggatgacacacgtggctcggggcttagactccgac
ggcgccttgctgcttgatgtcattgtgagtggccaggtcctacagctccactcacctgct
gaagtcggtgtgaaggattacacagaggactacattcaaacaggacccggtcagctctat
gcctactcaactcgtctgttcaccatcgatggcatcagtatcccctatacgtggaaccac
accattttctatgatcaggcctgggggaaaatgcctttcttagtagagacacttcatgca
tcttccatagagtctgactacaaccaactagaagagacactgggttttaaaatccatgct
tcaatttccaaaggagatcgcagtaaccagtgcccctctgggttcattttagactcggtt
ggacccttttgtgcagatgaagatgaatgcacagctgggaacccctgctctcatacctgc
cacaatgccataggagcctattactgctcctgccccaaaggcctcaccatagctgcagat
gggagaacctgtcaagacattgatgagtgtgctttgggtggacatacctgtcgtgctggt
caggactgtgacaacaccattggatcctatcgctgtgtggtccattgtggaacaggcttc
cgaagaacctctgatgggttaagctgtcaagatattaatgaatgtcaggagtccagcccc
tgtcaccagcgatgtttcaacgtcataggaagtttccattgtggatgtgaagctggctat
caactcaaaggcagaaaatgcatcgatgtgaatgaatgtagacagaatgtgtgcagacca
gaccagcattgtaagaacacccgcggtggctacaagtgcattgatctttgtccaagtgga
atgaccaaggctgaaaatgggacctgcattgacatagatgagtgcaaagatgggacccat
cagtgcagatataaccaaatatgtgagaacacgagaggcagctaccggtgtgcatgccca
aggggttatcggtcccaaggtgttggaagaccctgtattgacattaatgaatgtgagcaa
gtacctaagccttgtgcacatcagtgctccaacagccccggcagcttcaagtgtatctgt
ctgccaggacagcagttgttaggggatgggaaatcttgcgctggattggagaggctgtcg
aattatggcactcagtacagtagctatacccttgagcggttctcccctgtgagaagcgac
tatcaaccttcgcagcattacagacagtactcacaactctacagctcctactcagagtat
aggaacagcagagcatctttctccaggaatagaaggactattaggaaaacttgccctgaa
ggctctgaggcaaaccatgagacatgtgtagatattgatgaatgtcaaaacagagacact
tgccaacacgagtgtaaaaacacgatcgggagctaccagtgcgtctgcccaccaggttat
cgactcatgctcaatgggaaaacgtgccaagatgtagatgagtgcctggagcagaatgtc
cgctgtggaccaaatcgaatgtgtttcaacatgagaggaagctaccagtgcatcgacaca
ccctgcccacccaactaccaacgggatcctgttttggggttctgccttaagaactgtcca
cccaatgacttggaatgtaccttaagcccatatgccttggaatataaacttgtctccctc
ccatttggaatagccgccaatcaagatttaatccggctggttgcatacacacaggatggc
gtgatgcatcccaggacaactttcctcatgatagatgaggaaccagctgtcccttttgcc
ttaagggatgaaaacctgaaaggagttgtgtacactacacgtccactacgagaggcagag
acctaccgcatgaaggtgggagctttatcctacagtgccaatgggaccattgagtatcag
actacattcatagtttatatagctgtgtctgcctatccgtactag

DBGET integrated database retrieval system