KEGG   Mus musculus (house mouse): 54561
Entry
54561             CDS       T01002                                 
Symbol
Nap1l3, MB20
Name
(RefSeq) nucleosome assembly protein 1-like 3
  KO
K11281  nucleosome assembly protein 1-like 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    54561 (Nap1l3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    NAPs (Nucleosome assembly proteins)
     54561 (Nap1l3)
SSDB
Motif
Pfam: NAP
Other DBs
NCBI-GeneID: 54561
NCBI-ProteinID: NP_620081
MGI: 1859565
Ensembl: ENSMUSG00000055733
UniProt: Q794H2
Position
X:complement(121304257..121307082)
AA seq 544 aa
MAEADPKMVTEPGAHGVAEEAMASTACDSGDESDSNSSSSTNSCSSSGSSSSGSSSSSSS
SSSSSSSSSSSSSGSSGSSSNGSHLNRKKRVPEPSRRAQRRPSGKLFLDKLPQAVRNRVQ
ALRNIQNECDKVDTLFLRAIHDLERKYAELNKPLYDKRFQIINAEYEPTEEECEWNSEEE
FSGDEEMQDDTPNEMPPLEGEEEEESCNEKAEVKEEGTHVPEEVPEAKVEEEEAPKETPE
VKTEEKDIPKEGAEEKAEEQESSKEIPEVKGEEKADSTDCIDIAPEEKEDVKEVTQANTE
NKDQPTEEFTPRAPAREAQKRVPETRPEEGVNIKRARKGKPKKEDPKGIPDYWLTVLKNV
DKLGPMIQKCDEPILKFLSDVSLKFSNPGQPIGYTFEFHFLPNPYFRNELLMKTYIIRSK
PDHYDPFFAWGWEIEECKGCKIDWRRGKDVTVTTTRSRPGITGEIEVQPRVVPNASFFNF
FSPPEIPLIGKLEPREDAILDEDFEIGQILHDNVILKSIYYFTGEINDPYYHDFRDYGNR
KYYK
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggcagaagcggatcctaaaatggtcacagaacctggtgcccatggggttgctgaagag
gcgatggctagcacagcttgtgattctggggatgaatctgacagcaatagctctagcagt
accaatagttgcagcagcagcggcagcagcagcagcggcagcagcagtagcagcagcagc
agtagcagcagcagcagcagcagcagcagtagcagtagcggtagcagtggcagcagcagc
aatggcagtcatttgaaccgaaagaagagggtacctgagccttccagaagggcccagcga
cgtccctccgggaaacttttcttggataagctgccccaagccgtaagaaatcgggtgcag
gcactcagaaatattcagaatgagtgtgacaaggtagacaccttgttcttaagggcaatt
catgatcttgaaagaaagtatgctgaactcaataagcctctatatgataagcgttttcag
atcataaatgcagaatatgagcctacagaggaagaatgtgaatggaattcagaagaagag
ttcagtggtgatgaagaaatgcaggatgacacacctaatgaaatgccacccttagagggt
gaggaggaagaagaaagctgtaatgaaaaagctgaagtgaaggaagaaggaacacatgtt
ccagaagaagttcctgaggcaaaagttgaagaagaggaggctcccaaagaaactcctgag
gtgaaaactgaagaaaaagacattccaaaagaaggtgctgaagaaaaagctgaagaacag
gaatcctctaaagaaattcctgaggtaaaaggtgaagaaaaagcagactctacggattgt
atagatatagctcctgaagaaaaagaagacgtcaaagaagttacccaggcaaatacagaa
aataaggatcaacctacagaagaatttacaccaagggctccagcaagagaggctcaaaaa
agggtccctgagacaaggcctgaagaaggagtcaatattaaaagggctcgaaagggaaaa
cctaagaaagaagatcctaaaggtattcctgactactggctgactgttttaaagaatgtt
gataagcttgggcctatgattcaaaagtgtgatgaacccattttgaagttcttatctgat
gtgagcctgaagttctcaaaccctggccagcctattggttacacttttgaatttcatttc
ctacctaacccatacttcagaaatgagctcctgatgaagacatacataataaggtcaaaa
ccagatcactacgacccgttcttcgcgtggggatgggaaattgaagagtgtaaaggctgc
aaaatagactggagacgaggaaaagatgttacggtgacaaccacccggagtcgccctggt
attacaggggaaattgaagtccagccaagagtggttcctaatgcatccttcttcaatttc
ttcagtcctcctgagattcctttgattgggaagctggaaccaagagaagatgctatcctt
gatgaggactttgagattggtcaaattttgcatgataatgtcatcttgaagtcaatctat
tacttcacaggagaaatcaatgatccctactaccatgacttcagggattatggaaatagg
aagtactacaagtag

DBGET integrated database retrieval system