KEGG   Mus musculus (house mouse): 54562
Entry
54562             CDS       T01002                                 
Symbol
Dnaaf11, LRTP, Lrrc6
Name
(RefSeq) dynein axonemal assembly factor 11
  KO
K19753  dynein axonemal assembly factor 11
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    54562 (Dnaaf11)
   04812 Cytoskeleton proteins [BR:mmu04812]
    54562 (Dnaaf11)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Dynein assembly factors
   54562 (Dnaaf11)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     Dynein-related proteins
      54562 (Dnaaf11)
SSDB
Motif
Pfam: LRR_9 LRR_4 LRR_8 DUF4195
Other DBs
NCBI-GeneID: 54562
NCBI-ProteinID: NP_062330
MGI: 1859553
Ensembl: ENSMUSG00000022375
UniProt: O88978
Position
15:complement(66251707..66372769)
AA seq 473 aa
MGRITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIE
NVSKLKKLEYLNLALNNIERIENLEGCEWLTKLDLTVNFIGELSSVKTLTHNIHLKELFL
MGNPCADFDGYRQFVVVTLQQLKWLDGKEIERSERIQALQNYTSVEQQIREQEKAYCLRR
AKEKEEAQRKLEEENESEDKKKSSTGFDGHWYTDIHTACPSATENQDYPQVPETQEEQHN
TKESDDIEDDLAFWNKPSLFTPESRLETLRHMEKQRKAQDKLSEKKKKAKPPRTLITEDG
KVLNVNEAKLDFSLKDDEKHNQIILDLAVYRYMDTSLIEVDVQPTYVRVMVKGKPFQLAL
STEVQPDRSSAKRSQTTGHLLICMPKVGEMITGGQRTPTSVKTTSTSSREQTNPRKKQIE
RLEVDPSKHSCPDVSTIVQEKRHRPKRMESQPRDEPSEEDPDFEDNPEVPPLI
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgggccgaatcacagaagatcttattagacggaatgctgagcacaatgactgtgtaatt
ttttccctggaggaactctccttgcatcagcaagaaatagaaaggctagaacatattgac
aaatggtgccgggacttaaaaattctctatcttcaaaataacctcattggaaaaattgaa
aatgttagcaaactgaagaaacttgaatatttgaacttagcattgaacaacattgaaaga
attgaaaacttggaaggatgtgagtggctgacaaaacttgacttgactgtaaatttcatt
ggagaactgagcagcgttaaaaccctgacacacaatattcatctgaaggagttgttcctc
atgggtaacccatgtgctgactttgatggctacaggcagtttgtggtggtgaccttacaa
cagttaaagtggttggatggcaaagaaatagagcgttctgaaaggatccaggcattgcag
aactacacatcagttgagcagcaaatcagagagcaggagaaagcttactgccttagacga
gccaaagagaaagaggaagctcagaggaaactcgaggaagaaaatgaaagtgaagacaag
aagaagagcagcacaggctttgatgggcattggtacacagacatccacactgcttgccca
tctgccacagaaaaccaagactacccccaggtaccagaaactcaagaagagcaacacaac
acaaaggaatcagatgacattgaagatgatctggcattctggaacaaaccgtctttgttc
acccctgaatctagactggaaactctcagacacatggaaaaacagcgaaaagcccaagat
aagttaagtgaaaagaaaaagaaagcgaaaccaccccgcactttgattacagaagatggg
aaagtcctgaatgtcaacgaagccaaacttgatttctctttgaaagatgatgagaaacac
aatcagatcatcctggacctggctgtctataggtacatggatacctctttgattgaggtt
gatgtgcagccaacttacgttcgagtaatggtcaaaggaaagccatttcaacttgccctt
tctacagaggtccagcctgaccgcagctctgctaaaaggtcccagacaacaggacatttg
ctgatctgcatgcccaaggtaggagaaatgatcacaggaggtcaacgaacacccacgtct
gtgaaaaccacctcaactagtagcagggaacaaacaaaccccagaaaaaagcagatagaa
agattggaagttgaccccagcaagcattcttgccctgatgtgtctaccatagtacaagag
aaaagacacagacccaaaagaatggaatctcaaccccgagatgaacccagtgaggaagat
ccagactttgaggataacccagaagtgcctccactaatttga

DBGET integrated database retrieval system