KEGG   Mus musculus (house mouse): 54563
Entry
54563             CDS       T01002                                 
Symbol
Nup210, 9830001L10, AI836801, Pom210, gp190, gp210
Name
(RefSeq) nucleoporin 210
  KO
K14314  nuclear pore complex protein Nup210
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    54563 (Nup210)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    54563 (Nup210)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    54563 (Nup210)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     54563 (Nup210)
SSDB
Motif
Pfam: Big_2
Other DBs
NCBI-GeneID: 54563
NCBI-ProteinID: NP_061285
MGI: 1859555
Ensembl: ENSMUSG00000030091
UniProt: Q9QY81 Q8BPS7
Position
6:complement(90990049..91095920)
AA seq 1886 aa
MARASLVQPALWALLLLQVVGPAAAAKLNIPKVLLPFTRATRVNFTLEASEGCYRWSSTR
PEVASIEPLGSSEQQCSQKAVVQARLTQPARLTSIIFAEDITTGQVLRCDAIVDLIHGIQ
IVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFDWTIVKDTEANGFSDSHNALRIL
TFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLIL
ENILLNPAYDVYLLVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPDPQGDPARPV
AILTQDTSRVTAMQMGQSNLVLGHRSIRMQGASRLPNSTIYVVEAGYLGFTVYPGDRWVL
ETGHLYAITIEVFDRSSNKVYPSDNIRIEAVLPAEFFEVLSSSQNGSYHHIRAIQSGQTA
ISATLTSVVDQDGGVHVLQVPVWNQQEVDIHIPITLYPSILTFPWQPKTGAYQYTIKAHG
GSGNFSWSSSSSMVATVTVKGVMTTSGDTGLSVIRAHDVQNPLHFGEMKVYVIEPSSMEF
APCQVEARVGHTLELPLTISGFMPGGGSEVVTLSDCSHFDLVVEVENQGVFQPLPGRLPP
GPEHCSGVKVKADAQGSTTLLVSYTHGHVHLDAKITLAAYLPLKAVDPSSVAVVTLGSSK
EMLFEGGPRPWVLEPSKFFRNVTSEDTGSISLSLLGPPASRNYQQHRVLMTCQALGEQVI
ALSVGNRPSLSNPFPAVEPTVVKSICAPPSRLTLMPVYALPQLDLSCPLLQQNKQVVPVS
SHRNPLLDLGAYDQQGRRFDNFSSLSIQWESSRPLLASIELDQPMQLVSQDDGNGQKKLH
GLQTVSVHEASGTTAISATATGYQQSHLSEARVKQPHDPLVPVSASIELILVEDVRVSPE
EMTIYNHPGVQVELYITEGSGYFFLNTSTQDIIKVAYQDTRGVALVHPLLPGSSTVMVHD
LCLAFPAPAKAIIHVSDIQELYVRVVDKVEIGKAVKAYVRVLDFYKKPFLAKYFTFMDLK
LQAASQIITLVTLDEALDNYTATFLVHGVAIGQTSLSASVTDKSGQRVSSTPQQIEVFPP
FRLIPRKVTLIIGAMMQITSEGGPQPQSNILFSINNESVAAVSSSGLVRGLMVGNGSVLG
VVQAVDAETGKVIIVSQDLVEVEVLQLQAVRIRAPITRMRTGTQMPVFVTGITSNQSPFS
FGNAVPGLTFHWSVTKRDVLDLRGRHHEVSIRLPPQYNFAMNVYGRVKGRTGLRVVVKAL
DPTAGQLHGLGKELSDEIQIQVFEKLRLLNPEIEAEQILMSPNSFIKLQTNRDGAAILSY
RVLDGPEKAPIVHTDEKGFLVSGSGIGVSTLEVIAQEPFGTNQTILVAVKVSPVSYLRIS
MSPVLHTQHKEALTALPLGMTVTFIVHFHDSSGDIFHAHNSVLNFATNRDDFVQIGKGAT
NNTCIIRTVSVGLTLLHVWDVEHLGLSDFVPLPVLQAITPELSGAVVVGDILCLASVLTS
LGGVSGTWSSSASHVLYVDPKTGVAIARDAGSVTVYYEIAGQLKTFKEIVVGTPQKIVAR
RLHSAQTSIQEATASKVTVSVGDRSSNLLGECSPAQREAIEALHPESLISCQLQFKQDVF
DFPACDVFTVEPGFDAALGQYLCSVTMRRLTDKQLKHLNMKKTSLAVTASIPSSYTSVEK
VGAEVPFSPGLYANQAEILLSNHYTSSEVKVFGAVESLENLEVKSGSPAVLAFVKEKSFG
LPSFITYTVGVLDPTAGSQGPLSTALTFSSPATNQAITIPVTVAFVLDRRGPGPYGASLL
SHFLDSYQVMFFTFFALLAGTAVTIIAYHTVCAPRELASPLALTPRASPQHSPHYLASSP
AAFNTLPSGRKASPPSGLWSPAYASH
NT seq 5661 nt   +upstreamnt  +downstreamnt
atggcgcgggcctcactagtgcagccggcgctctgggcgctgctgttgctgcaggtagtg
ggtcccgccgcggccgccaagcttaacattcccaaggtgctgctgcccttcacgcgggcc
acgcgcgtgaacttcactctggaagcttctgagggctgctaccgctggtcatccacccgg
ccagaggtagccagcatagagccgttgggctccagtgaacagcagtgctcccagaaggca
gtggtgcaggcccgcttgacccagccagcccgcctgaccagcatcatctttgcagaagac
atcactacagggcaggtgctgcgctgtgacgccatcgttgatctcatccacggcattcag
attgtctctaccacccgtgagctctatcttgaggactctccactggagctgaagatccag
gctctggactcagaagggaataccttcagcaccttggcaggactggtcttcgactggaca
attgtgaaggatacagaggccaatggattctcagactcccacaatgcactccgcatcctc
accttcttggaatctacgtatatcccaccttcctacatctcagagatggagaaggcagcc
aagcagggcgacaccatcctagtgtctgggatgaagactggaagctccaagctcaaggct
cgaattcaggaggctgtctataagaatgttcgccctgcggaagtcaggctgctgatcttg
gagaacatccttctgaatccagcctatgatgtctacctgctggtgggaacctccattcac
tacaaggttcagaagatcaggcagggcaagattacagaactctcaatgccttctgatcaa
tatgagctgcagctccagaacagcatcccagatcctcagggagaccccgcccgtcctgtg
gccatcctgacacaggacacatcaagagtcactgccatgcagatgggacagagcaacctg
gtcctgggccacaggagtatccgtatgcaaggagcttctaggctccccaacagcaccatc
tatgtggttgaagccggatacctaggtttcacagtctaccctggtgacagatgggtgctt
gagactggacatctgtatgcaattaccatcgaagtatttgataggtccagcaacaaggtc
tacccatctgacaacatccgaattgaagctgtgcttcctgctgagttttttgaggttctg
tcgtcttcccagaatgggtcttatcatcacatcagggctatccagagtggccagacggcc
atcagtgcaaccctcacctctgtggtggaccaggacggaggggtccatgtgcttcaggta
cctgtgtggaaccagcaagaagtggacattcatatccccatcacactctatcccagcatc
ctgacatttccatggcaaccaaagacaggcgcctatcagtataccataaaggcccatggg
ggcagtgggaacttcagctggtcttcgtcaagctccatggttgccacagtcaccgtcaag
ggggtcatgaccacaagtggtgacactggcctcagtgtgatccgggcgcacgatgttcag
aatcctctccattttggcgagatgaaggtgtatgtgattgagcccagcagcatggagttt
gccccgtgccaggtggaggctcgagtgggtcacaccctggagctgcccctgacaatcagt
ggcttcatgcccggtgggggcagtgaggtggtcaccctgagcgactgctcccatttcgac
ctggtggtggaggtggagaaccagggtgtgttccagccattgccagggaggctgccgcca
ggacctgagcactgcagtggggtcaaagtgaaagctgatgcccagggatctaccaccctc
ctcgtgagctacacacacggccatgtacacttggatgcaaagatcactcttgctgcctac
ctgcccctcaaggctgtggatccctcttctgttgctgtggtgaccctaggctcctcaaag
gaaatgctgtttgaaggaggccccaggccatgggtcctggaaccttccaaattctttcgg
aatgtcacttctgaagacacaggcagcatcagcctgtctctcttgggtcctccagcctcc
cggaattaccagcagcaccgggtcctcatgacctgccaggccttgggtgagcaggtcatt
gctttgtccgtggggaaccggcccagcctctctaaccccttccctgctgtggagcccact
gtggtgaagtccatctgtgccccaccatccaggctcactctcatgcctgtctatgccctc
ccgcagctggacctatcctgcccattgctgcagcagaataagcaggtggttccagtatcc
agtcaccgtaatcccctgttagacctgggtgcctatgaccaacagggccggcgattcgat
aacttcagctctctgagcatccagtgggagtcctcccggccattgctggccagcattgag
cttgaccagcccatgcagctggtatcccaggatgatgggaatggccaaaagaaactacat
ggtttgcagacagtctcggttcacgaggcatcaggaaccacagccatctctgccacagcg
actggctaccagcagtcccacctgagcgaagccagagtgaagcaaccgcatgaccctcta
gtacctgtgtcagcctccattgaacttattctcgtagaggatgtgagggtcagtccagaa
gaaatgaccatttataaccatcctggtgtccaggtggaactctacatcacagaaggctct
ggatacttcttcctcaacacaagcacccaggacatcatcaaggtggcctaccaggacacc
cggggcgtagctctggtgcaccctctgctcccaggctcatcaactgtcatggtccatgac
ttgtgcctggccttcccagcccccgcaaaggccatcattcacgtctccgacatccaggag
ctctatgttcgagtggtggacaaggtggagatcgggaaggctgtcaaagcctacgtccgt
gtgttggacttctacaagaagcctttcctggccaagtacttcacctttatggacctgaag
ctgcaagcagcctcccagataatcacgctggtgactctggatgaagctctagacaactac
acggccacattcctcgtgcatggtgtggccattggccagaccagcctgtctgcaagcgtg
acggacaaatctgggcagagagtcagctccaccccacaacaaatcgaggtcttcccccca
ttcagattgatacccaggaaggtgacactgatcattggagccatgatgcagatcacctct
gaggggggcccccagcctcagtccaacatcctcttctccatcaacaatgagagtgtggca
gcagtgagcagctctgggctggtgcgtgggctcatggtcggcaatggctctgtgctggga
gtcgtgcaggcggtggatgcagagactggcaaggtcatcatcgtctcccaggatcttgtc
gaagtagaggtgctacagctccaggcagtgaggatccgtgccccaatcacacggatgagg
accgggacccagatgcctgtctttgtcaccggaatcaccagcaaccagagccctttctcc
tttggcaatgctgtgccaggcctgaccttccactggtctgtcaccaaaagggatgtcctg
gaccttcgagggcggcaccatgaggtatctatccggctcccgcctcagtataattttgcc
atgaatgtgtatggccgagtgaaaggtcggactggacttcgggttgtagtcaaagctctg
gaccccacagctggccagctgcatggtctcggcaaggagctctcagatgagatccaaatt
caggtatttgaaaaactgcggctgctgaaccctgaaatagaagcagaacaaatactaatg
tcacccaactcatttataaagctgcagacaaacagggatggtgcagccattctgagctac
cgtgtccttgatgggcctgagaaggctcccattgttcacactgatgagaaggggtttctg
gtgtcgggctctggaattggagtgtccaccctcgaagtgattgcacaggagcctttcggc
accaaccagactatccttgtcgctgtaaaggtctctcctgtttcatacctgaggatctcc
atgagcccagtcctgcacactcagcacaaggaggcgctgacagctctgcctctggggatg
accgtgaccttcattgtccacttccacgacagctctggagacatcttccatgctcataat
tcagtcctcaattttgccactaacagagatgacttcgtgcagatcggcaagggtgccacc
aacaacacctgcatcatccgcacagtcagtgtgggcttgacgctgctccatgtgtgggat
gtggagcacctcggcctctccgacttcgtaccactacctgtcctacaggccatcacccca
gagttgtctggagccgtggtggtgggtgacatcctctgtctggctagtgttcttactagc
ctgggaggtgtctcagggacatggagctcctcagccagccatgtcctctacgttgaccct
aagacaggcgtggctatagcccgagatgcagggtctgtgactgtttactacgagatcgct
gggcagctgaagaccttcaaggagatagtggtcggcacccctcagaagattgtggcccgt
cgcctccactctgcccagaccagtatccaggaagccacagcctccaaagtgactgtcagc
gtgggagacaggagctctaacctacttggtgagtgctcccctgcccagcgagaggccatt
gaagccttgcaccccgagtccctcatcagctgccaactccagttcaagcaagatgtcttt
gacttccctgcttgtgatgtcttcaccgtggaaccaggatttgatgctgctctgggccag
tacctctgctcggttactatgcgcaggctgacagataagcaactgaagcacttgaacatg
aagaagacatcactggcagtcactgcctccatccccagcagttatacctctgtagagaag
gtgggagctgaggtccccttcagtccagggctctatgccaaccaggcagaaatccttttg
agcaaccactataccagctccgaggtcaaagtctttggtgctgtggagagtctggaaaac
ttggaggtgaaatctggatccccggcagtgctagccttcgtgaaagagaagtcatttggg
ctacccagcttcatcacgtacacagtgggtgtcttggatcccacagctggcagccagggc
cctctgtccactgccctgaccttctccagccctgccactaaccaggccatcaccattcca
gtcaccgtggcctttgtgttggatcgtcgtgggcctggtccctatggagccagcctcctg
tcacacttcctggactcctatcaagtcatgttcttcaccttttttgctctgctggctggg
acagcagtcaccattatagcctaccatacagtctgtgcaccccgggaacttgcttcaccc
ctggccctcacgccccgtgccagccctcagcacagcccccactatcttgcctcatctccg
gctgctttcaacacactgccttctggtcgcaaagccagccctccctcggggctctggagc
ccagcctatgcctctcactag

DBGET integrated database retrieval system