KEGG   Mus musculus (house mouse): 545884
Entry
545884            CDS       T01002                                 
Symbol
Gm5885, EG545884
Name
(RefSeq) predicted gene 5885
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Pro-rich
Other DBs
NCBI-GeneID: 545884
NCBI-ProteinID: NP_001171969
MGI: 3648672
Ensembl: ENSMUSG00000095412
Position
6:133506152..133509725
AA seq 174 aa
MLVVLLTAALLVLSSAQRAEEDLNNDNTSGVQPIPNPAEKTQDSELGPSAAAANIGNIQE
SSPLVKVDPSSNSGNEQQVEPEESQQAESQEHCDSSGKQEKNQPRKRNVVEVKNLSSSPE
NSQGSPQQIHSKQKPLIEGGSGQERVPPPLHPPKFFRPRVPNNYVPFWLGPRRN
NT seq 525 nt   +upstreamnt  +downstreamnt
atgcttgtggtcctgctcacagcagccttgctagtcctgagctcagctcagagggcagag
gaagatttgaacaatgataatacatctggtgtccaaccaatacccaaccctgcagagaaa
acccaggactcagagttaggtccttctgctgctgctgcaaatatagggaatatccaagaa
tcatcaccattagtaaaagtggatccttcatccaactctgggaatgaacagcaagtagaa
ccggaggaatcacaacaggcagagagtcaagagcattgtgactcctctggaaaacaagag
aaaaatcaacctagaaaaagaaatgtagtggaggttaaaaatctttcttcatctcctgaa
aactcacaaggttcaccccaacaaatacattcaaagcagaaacctttgattgagggagga
tctggtcaagagagagtacctcctcctttacatcctcctaaatttttccgaccacgagta
cctaataattatgtacctttttggcttgggccccggagaaattag

DBGET integrated database retrieval system