KEGG   Mus musculus (mouse): 54598Help
Entry
54598             CDS       T01002                                 

Gene name
Calcrl, AV071593, CRLR
Definition
(RefSeq) calcitonin receptor-like
  KO
K04577  calcitonin receptor-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    54598 (Calcrl)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    54598 (Calcrl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    54598 (Calcrl)
G protein-coupled receptors [BR:mmu04030]
 Secretin receptor family
  Calcium-regulating peptide
   Calcitonin
    54598 (Calcrl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM DUF4034
Motif
Other DBs
NCBI-GeneID: 54598
NCBI-ProteinID: NP_061252
MGI: 1926944
Ensembl: ENSMUSG00000059588
Vega: OTTMUSG00000013406
UniProt: Q9R1W5 A2AR99
Position
2; 2 D
AA seq 463 aa AA seqDB search
MDKKHILCFLVLLPLNMALISAESEEGVNQTDLGVTRNKIMTAQYECYQKIMQDPIQQAE
GLYCNRTWDGWLCWNDVAAGTESMQYCPDYFQDFDPSEKVTKICDQDGHWFRHPDSNRTW
TNYTLCNNSTHEKVKTALNLFYLTIIGHGLSIASLIISLIIFFYFKSLSCQRITLHKNLF
FSFICNSIVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGVYLHTLI
VVAVFAEKQHLMWYYFLGWGFPLLPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICAA
LLVNLFFLLNIVRVLITKLKVTHQVESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKVA
EEVYDYVMHILMHFQGLLVATIFCFFNGEVQAILRRNWNQYKIQFGNGFSHSDALRSASY
TVSTISDMQGYSHDCPTEHLNGKSIQDIENVALKSENMYDLVM
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaagcatatactatgttttctggttctcttgcctcttaatatggctctcatc
tcagcagagtcggaagaaggcgtgaaccaaacagacttgggagtcactagaaacaagatc
atgacggctcaatatgaatgttaccagaagatcatgcaggaccccattcaacaagcagaa
ggcctttactgcaataggacctgggacggatggctatgctggaatgacgttgcagcaggg
acggaatcaatgcagtactgccctgactattttcaggattttgatccttcagagaaggtt
acaaagatctgtgaccaagatggacactggtttcggcatccggatagtaatagaacatgg
accaactacaccctgtgtaataacagcacgcatgagaaagtgaagacagccctgaatctg
ttctacctaactataattggacatggattatctattgcatctctgatcatctctctcatc
atatttttttacttcaagagcctaagttgccaacggatcacattgcataaaaacctgttc
ttttcatttatttgtaattcgattgtaacaatcatccacctcacggcagtggccaataac
caggccttagtggccacaaatcctgtgagctgcaaagtgtctcagtttatccatctctac
ctgatgggctgtaactacttctggatgctctgtgaaggcgtttacctgcacacactcatc
gtggtggctgtgtttgcggagaagcagcacttgatgtggtattattttctcggctggggg
tttcctctgcttcctgcctgcatccacgccattgccagaagcttgtattacaacgacaat
tgctggatcagctcagacactcatctcctctacattatccatggtccgatttgtgctgct
ttgttggtaaatctctttttcctattaaatattgtacgtgttctcatcaccaagttgaaa
gttacacaccaagtggaatccaatctctacatgaaagccgtaagagctactctcatcttg
gtaccactacttggcattgaatttgtgctttttccgtggcggcctgaaggaaaggttgca
gaggaggtgtatgactatgtcatgcacattttgatgcactttcagggtcttttggtggct
actattttctgcttctttaatggagaggttcaagcaattctgagaagaaattggaaccag
tataaaatccaatttggaaatggcttttcccactctgatgctctccgcagtgcatcctac
acagtgtcaacaatcagtgacatgcaagggtacagccatgactgccccactgaacactta
aatggaaaaagcatccaggatattgaaaatgttgccttaaaatcagaaaatatgtatgat
ctagtgatgtga

DBGET integrated database retrieval system