KEGG   Mus musculus (house mouse): 54608
Entry
54608             CDS       T01002                                 
Symbol
Abhd2, 2210009N18Rik, LABH2, Labh-2
Name
(RefSeq) abhydrolase domain containing 2
  KO
K13697  abhydrolase domain-containing protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    54608 (Abhd2)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   54608 (Abhd2)
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Peptidase_S9 Ndr Cutinase DUF915 VirJ
Other DBs
NCBI-GeneID: 54608
NCBI-ProteinID: NP_061281
MGI: 1914344
Ensembl: ENSMUSG00000039202
UniProt: Q9QXM0
Position
7:78923002..79015257
AA seq 425 aa
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCP
LLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEH
CVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYG
CTWEFGAMVNYIKRTYPQTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSAL
RAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL
MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLS
EKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKSQCSDTEQM
EAELE
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaatgccatgctagagacccccgagctccccgccgtgtttgatggggtgaagctggct
gccgtagctgccgttctctacgtcatcgtgcggtgtttgaacctgaagagccctactgcc
cctcctgacctctacttccaggactccgggctctcacgtttcctgctcaaatcctgtcct
cttctgaccaaagaatacattccaccactgatctgggggaaaagcggacatatccagaca
gccttgtatgggaagatggggagggtgaggtcaccacacccttacgggcaccgcaagttc
atcaccatgtcggatggtgccacttctaccttcgacctcttcgagcccctggctgagcac
tgtgttggagatgacatcaccatggtcatctgtcctggaattgccaaccacagcgagaag
cagtatatccgaaccttcgttgactatgcccagaaaaatggctaccggtgcgcagtgcta
aaccacctgggagccctccccaacattgagctgacctccccacgaatgttcacctatggc
tgcacgtgggaatttggagccatggtgaactacatcaagaggacatatccccagacccag
ctggtcgtcgtgggcttcagcctgggtggtaacatcgtgtgcaaatacttgggggagacg
caggcaaaccaggaaaaggtcctgtgctgtgtcagtgtgtgccaggggtacagcgcactg
agggcccaggagaccttcatgcagtgggaccagtgccgcaggttctacaacttcctcatg
gccgacaacatgaagaagatcatcctgtctcacagacaagctctctttggagaccacgtt
aagaaaccccagagcctggaggacacggacttgagccggctgtacacagcaacatccctg
atgcagattgatgacaatgtgatgagaaagttccatggctataattccctgaaggaatac
tatgaggaagagagctgcatgaggtacctgcacaggatatatgtgcctctcatgctggtt
aatgcagctgacgaccccttggtgcacgaaagccttctaaccattccaaagtctctctca
gagaaacgggagaatgtcatgttcgtgctgcctctgcatgggggccacctgggcttcttc
gagggctccgtgctgttccccgagccgctgacatggatggataagctggtagtggagtat
gccaatgccatttgccaatgggaaaggaataagtcccagtgctcagacacggagcagatg
gaggccgagttggaatga

DBGET integrated database retrieval system