KEGG   Mus musculus (mouse): 54608
Entry
54608             CDS       T01002                                 

Gene name
Abhd2, 2210009N18Rik, LAB, LABH2, Labh-2
Definition
(RefSeq) abhydrolase domain containing 2
  KO
K13697  abhydrolase domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    54608 (Abhd2)
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Peptidase_S9 Ndr DUF2637 Cutinase DUF915 VirJ
Other DBs
NCBI-GeneID: 54608
NCBI-ProteinID: NP_061281
MGI: 1914344
Ensembl: ENSMUSG00000039202
Vega: OTTMUSG00000029104
UniProt: Q9QXM0
Position
7; 7 D2
AA seq 425 aa
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCP
LLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEH
CVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYG
CTWEFGAMVNYIKRTYPQTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSAL
RAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL
MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLS
EKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKSQCSDTEQM
EAELE
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaatgccatgctagagacccccgagctccccgccgtgtttgatggggtgaagctggct
gccgtagctgccgttctctacgtcatcgtgcggtgtttgaacctgaagagccctactgcc
cctcctgacctctacttccaggactccgggctctcacgtttcctgctcaaatcctgtcct
cttctgaccaaagaatacattccaccactgatctgggggaaaagcggacatatccagaca
gccttgtatgggaagatggggagggtgaggtcaccacacccttacgggcaccgcaagttc
atcaccatgtcggatggtgccacttctaccttcgacctcttcgagcccctggctgagcac
tgtgttggagatgacatcaccatggtcatctgtcctggaattgccaaccacagcgagaag
cagtatatccgaaccttcgttgactatgcccagaaaaatggctaccggtgcgcagtgcta
aaccacctgggagccctccccaacattgagctgacctccccacgaatgttcacctatggc
tgcacgtgggaatttggagccatggtgaactacatcaagaggacatatccccagacccag
ctggtcgtcgtgggcttcagcctgggtggtaacatcgtgtgcaaatacttgggggagacg
caggcaaaccaggaaaaggtcctgtgctgtgtcagtgtgtgccaggggtacagcgcactg
agggcccaggagaccttcatgcagtgggaccagtgccgcaggttctacaacttcctcatg
gccgacaacatgaagaagatcatcctgtctcacagacaagctctctttggagaccacgtt
aagaaaccccagagcctggaggacacggacttgagccggctgtacacagcaacatccctg
atgcagattgatgacaatgtgatgagaaagttccatggctataattccctgaaggaatac
tatgaggaagagagctgcatgaggtacctgcacaggatatatgtgcctctcatgctggtt
aatgcagctgacgaccccttggtgcacgaaagccttctaaccattccaaagtctctctca
gagaaacgggagaatgtcatgttcgtgctgcctctgcatgggggccacctgggcttcttc
gagggctccgtgctgttccccgagccgctgacatggatggataagctggtagtggagtat
gccaatgccatttgccaatgggaaaggaataagtcccagtgctcagacacggagcagatg
gaggccgagttggaatga

DBGET integrated database retrieval system