KEGG   Mus musculus (mouse): 54609
Entry
54609             CDS       T01002                                 

Gene name
Ubqln2, Chap1, Dsk2, HRIHFB2157, Plic-2, Plic2
Definition
(RefSeq) ubiquilin 2
  KO
K04523  ubiquilin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54609 (Ubqln2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    54609 (Ubqln2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    54609 (Ubqln2)
   03051 Proteasome [BR:mmu03051]
    54609 (Ubqln2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    54609 (Ubqln2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    54609 (Ubqln2)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD YukD Rad60-SLD_2 DUF2407 Ubiquitin_5 Atg8 Tir_receptor_C Ubiquitin_4
Other DBs
NCBI-GeneID: 54609
NCBI-ProteinID: NP_061268
MGI: 1860283
Ensembl: ENSMUSG00000050148
Vega: OTTMUSG00000019381
UniProt: Q9QZM0
Position
X; X F3
AA seq 638 aa
MAENGESSGPPRPSRGPAAAPGAASPPAEPKIIKVTVKTPKEKEEFAVPENSTVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLMQHGIHDGLTVHLVIKSQNRPQGQATTQPSTTA
GTSTTTTTTTTAAAPAATTSSAPRSSSTPTTTNSSSFGLGSLSSLSNLGLNSPNFTELQN
QMQQQLLASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPD
IMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGG
NPFATVGSSSTSGEGTQPSRTENRDPLPNPWAPPPTTQTAATTTTTTTTSSGSGSGSSSS
STTAGNTMAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDMA
AQMMLSSPLFTSNPQLQEQMRPQLPNFLQQMQNPETIAAMSNPRAMQALMQIQQGLQTLA
TEAPGLIPSFAPGVGMGVLGTAITPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPASSPG
STGTGIPPATTVSSSAPTETISPTSESGPNQQFIQQMVQALTGGSPPQPPNPEVRFQQQL
EQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggctgagaacggcgagagcagcggccccccgcgcccctcccgcggccctgcggcggcc
ccaggcgcggccagcccgccggccgagcccaaaatcatcaaagtcactgtgaagaccccc
aaagagaaggaggagttcgcggtgcccgagaacagcaccgtgcagcagttcaaggaagcg
atttccaaacgcttcaaatcgcagaccgatcagctcgtgctgattttcgccggaaagatc
ctgaaagatcaagataccttgatgcagcatggcatccatgatggactgactgttcacctg
gttatcaaaagccagaaccgtccgcagggccaggccaccacgcagcccagcacgactgcg
ggaacgagcacgacgaccacgaccaccaccacggcggcggcgccggcggcgacgacatca
tcggctcccaggagtagctccacacctaccaccacgaatagcagctcctttgggctggga
agcctttccagccttagtaacctgggcttgaactcgcccaacttcaccgagcttcagaac
cagatgcagcagcagctcctggccagccctgagatgatgatccagatcatggaaaatccc
tttgttcagagcatgctttcgaatcctgatctgatgaggcagctcatcatggccaatcca
cagatgcaacaattgatccagagaaacccagaaatcagccacctactgaacaacccagat
ataatgaggcagacgctggaaatcgccaggaatcctgccatgatgcaagagatgatgcga
aatcaagacctggctctcagtaatctcgaaagcatcccaggtggctacaatgctctgcgg
cgcatgtacactgacattcaagaacctatgctgaatgccgcacaggagcagtttgggggc
aacccgtttgccacggtggggagcagttccacctcaggggaaggtactcagccctcccgc
acggagaatcgtgatccgctgcccaatccttgggcaccaccgccaacaacccagacggct
gcgaccaccaccaccaccacgaccacaagcagtggcagtggctctggcagcagctccagc
agcaccaccgccgggaacaccatggctgcagctaattacgtggctagcatcttcagcacc
ccaggaatgcagagcctgctgcagcagataactgagaatccccagctgattcagaatatg
ctgtctgcgccctacatgcggagcatgatgcagtcgctgagccagaatccagatatggcg
gcccagatgatgctgagtagcccgctgttcacttcgaatcctcagctgcaggagcagatg
cgtccacagctcccgaatttcctgcagcagatgcagaatccagaaaccatcgcggccatg
tcaaacccgagagcgatgcaagcgctaatgcagatccagcaggggctacagactctagcc
actgaagcacctggcctcattcccagcttcgctccaggtgtggggatgggagtgctggga
accgccataacccctgtgggcccagtcactcccatagggcccatcggccctatagttcct
ttcacccccataggccccatcgggcctataggacccactggccctgcaagctcccccggc
tccaccggcactggcatcccgcctgcaaccactgtgtccagctctgcacctactgaaacc
ataagtccaacctcggaatctggacccaaccagcagttcattcaacaaatggtgcaggct
ctcactggaggaagccctccacagccgccgaatcctgaagtgagatttcagcagcaactg
gaacagctcaacgccatggggttcttaaaccgcgaagcaaacttgcaggccctaatagca
acaggaggcgacatcaacgcggccattgagaggctgctgggctctcagccatcctaa

DBGET integrated database retrieval system