KEGG   Mus musculus (mouse): 546118
Entry
546118            CDS       T01002                                 

Gene name
Ubtfl1, B020006M18Rik, Hmg, Hmgpi
Definition
(RefSeq) upstream binding transcription factor, RNA polymerase I-like 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: HMG_box HMG_box_2 Mis14
Other DBs
NCBI-GeneID: 546118
NCBI-ProteinID: NP_001028965
MGI: 3588290
Ensembl: ENSMUSG00000074502
Vega: OTTMUSG00000036484
UniProt: Q3USZ2
Position
9; 9 A2
AA seq 394 aa
MTSLDNQGLWSEKDILKLLECMEHNIPSDDSREFKKSQADLNWSKVAFGLFSGEMCKQKW
MEISYNLRKFRTLTELVQEAKFSFTKKTHKNKILTEHPDRPKRPLTAYLRFYKEQRAKYC
QMYPKYSNAQLTKILAEKYRQLPAEIKQRYIMDFKKEKEDFQKKMRQFKKRHPVSGHPKK
SVVPQSHPTKVPTKSQGDIKNVKSLVKTESPRTVSSDMKFQGEPRKPPMNAYHKFHQESW
SSPELRHLSFRKRWVEISRRWHQVPENEKEHYSNQVKRLQKQYRVKLDLWLKRLSPEEYA
AYKEAKATCGKRKNMSMSGGRSSKFGRTEQSSSEKGLQIKPGEVEELLDPGTDSSGTIQG
HHDGAQSSRQDFTDDSEEDDSSTSSDSSSTDEDD
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgacatcacttgataaccaaggcctttggtctgaaaaagacattctgaagttactggaa
tgcatggagcataatatcccatcagatgactccagagaattcaaaaagagccaggccgat
ctaaactggagcaaagtagcttttggactgttttcaggagaaatgtgcaaacagaaatgg
atggagatttcttataatttaaggaagttccgcacactgacagaattagtgcaagaagcc
aagttttcttttacaaaaaaaactcacaaaaataaaatactcacggagcatcctgaccga
cccaaaagacccttgactgcctatctgcgcttttacaaggaacagagagccaaatactgt
cagatgtaccctaagtacagcaacgcacagctgaccaaaatcctggctgagaaataccgt
cagctgccagcagagataaagcagagatatatcatggacttcaagaaggagaaagaagac
tttcagaaaaagatgaggcaattcaagaaaagacatcctgtttcagggcatcctaagaaa
tctgtggtgccccagagtcacccaaccaaagtccctacgaagtcacaaggagatataaaa
aatgtaaagtctcttgtaaaaacagaatctcccagaacagtttcttcagatatgaaattt
cagggagaacccaggaaaccccctatgaatgcatatcacaaatttcaccaagagtcatgg
tcaagtccggagctgaggcatctgtcctttaggaagcgctgggttgaaattagcaggcgt
tggcatcaagtcccagagaacgagaaagagcattatagcaatcaggtcaagaggctacag
aaacaatacagggtgaagctggatctctggctcaagagattgtctcctgaggaatatgct
gcatacaaagaggcaaaggccacctgtggtaagcgaaagaacatgagcatgtctggaggc
agaagctccaagtttggacgaacagagcagtcctcctcagagaaaggccttcaaataaag
cctggagaggtagaggagctattagatcctgggacagattcctcagggactattcagggt
catcatgatggcgcccagtcatccaggcaagatttcacggatgatagtgaagaagacgac
tctagcacctcctcagattctagtagtacagatgaagatgattaa

DBGET integrated database retrieval system