KEGG   Mus musculus (mouse): 54613Help
Entry
54613             CDS       T01002                                 

Gene name
St3gal6, 1700023B24Rik, AI930218, AW552396, Siat10, St3galVI
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 6
  KO
K03792  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 10) [EC:2.4.99.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    54613 (St3gal6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    54613 (St3gal6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     54613 (St3gal6)
Glycosyltransferases [BR:mmu01003]
 Terminal extension
  Sialyltransferase
   54613 (St3gal6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 54613
NCBI-ProteinID: NP_061254
MGI: 1888707
Ensembl: ENSMUSG00000022747
Vega: OTTMUSG00000025631
UniProt: Q8VIB3
Position
16; 16 C1.2
AA seq 329 aa AA seqDB search
MKGYLVAIFLSSIFLYYVLYCILWGTNGYWFPAEEMRTRNNVNNCFKKPAFANLLRFPQL
YPFLCRADFIKVAAMSGTNNFPLPYGIKTFETYFSSALSKLQSCDLFDEFDRVPCKRCVV
VGNGGVLKNKTLGATIDSYDVIIRMNNGPVLGHEEEVGTRTTFRLFYPESVFSDSSHYDP
NTTAVLVVFKPQDLRWLVEILLGKKINTQGFWKTPALKLIYKQYQIRILDPYITSEAAFQ
MLRFPRVFPKDQKPKHPTTGIIAITMAFHICSEVHLAGFKYNFYSPNSPLHYYGNATMSL
MKQNAYHNLTAEQLFLNDIIKKKMVINLT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggtatctggtggccatattcctgagttccatcttcctctattatgtactatac
tgtatactgtggggaacaaatggctattggttcccagctgaagaaatgaggactagaaac
aatgtcaataattgttttaaaaagccagctttcgccaatcttctgagatttcctcagctt
tacccatttctgtgcagagctgactttataaaggttgctgccatgtccggtaccaataat
tttccgttgccctatggaataaagaccttcgagacatatttcagctcggccctttcaaaa
ctgcagagttgtgatctctttgacgagtttgacagagtgccatgtaaaaggtgtgtggtg
gttggtaatggaggagtgttgaagaataagacattaggagcaacaattgactcctatgat
gtaataataagaatgaacaacggtcctgtcttaggccatgaagaggaagttgggacaaga
acaaccttcaggcttttttatccagagtctgtcttttcagactccagtcactatgacccc
aatactacagcggttctcgtcgtctttaagccacaggatttaaggtggctggtggaaata
ctgctaggtaaaaaaataaatactcaagggttttggaagacaccagccttaaaactgatc
tataaacaataccaaatcagaatattagatccatatatcaccagcgaagcagcttttcaa
atgcttcgttttcccagagtatttcccaaggatcagaaacccaaacaccctacaacagga
attattgccatcacaatggcctttcacatatgcagtgaagtgcacctcgctggttttaag
tacaacttttacagccccaacagtcctttacactactacgggaatgccaccatgtctttg
atgaagcagaatgcatatcacaatctgactgcagagcagctctttttaaacgacattata
aagaaaaaaatggtgatcaacttgacttaa

DBGET integrated database retrieval system