KEGG   Mus musculus (house mouse): 54616
Entry
54616             CDS       T01002                                 
Symbol
Extl3, 2900009G18Rik, Ext1l, mKIAA0519
Name
(RefSeq) exostosin-like glycosyltransferase 3
  KO
K02370  alpha-1,4-N-acetylglucosaminyltransferase EXTL3 [EC:2.4.1.223 2.4.1.224]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
mmu01100  Metabolic pathways
Module
mmu_M00059  Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    54616 (Extl3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    54616 (Extl3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.223  glucuronosyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
     54616 (Extl3)
    2.4.1.224  glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
     54616 (Extl3)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   54616 (Extl3)
SSDB
Motif
Pfam: Glyco_transf_64 Exostosin TPR_MLP1_2 ADIP DUF1664 MscS_porin Seryl_tRNA_N EXOC6_Sec15_N CCDC22_CC TBK1_CCD1 THOC7 CENP-H FapA
Other DBs
NCBI-GeneID: 54616
NCBI-ProteinID: NP_001347314
MGI: 1860765
Ensembl: ENSMUSG00000021978
Position
14:complement(65289508..65387322)
AA seq 919 aa
MTGYTMLRNGGVGNGGQTCMLRWSNRIRLTWLSFTLFIILVFFPLIAHYYLTTLDEADEA
GKRIFGPRAGSELCEVKHVLDLCRIRESVSEELLQLEAKRQELNSEIAKLNLKIEACKKS
IENAKQDLLQLKNVISQTEHSYKELMAQNQPKLSLPIRLLPEKDDAGLPPPKVTRGCRLH
NCFDYSRCPLTSGFPVYVYDSDQFAFGSYLDPLVKQAFQATVRANVYVTENAAIACLYVV
LVGEMQEPTVLRPADLEKQLFSLPHWRTDGHNHVIINLSRKSDTQNLLYNVSTGRAMVAQ
STFYAAQYRAGFDLVVSPLVHAMSEPNFMEIPPQVPVKRKYLFTFQGEKIESLRSSLQEA
RSFEEEMEGDPPADYDDRIIATLKAVQDSKLDQVLVEFTCKNQPKPSLPTEWALCGERED
RLELLKLSTFALIITPGDPHLLISSGCATRLFEALEVGAVPVVLGEQVQLPYHDMLQWNE
AALVVPKPRVTEVHFLLRSLSDSDLLAMRRQGRFLWETYFSTADSIFNTVLAMIRTRIQI
PAAPIREEVAAEIPHRSGKAAGTDPNMADNGDLDLGPVETEPPYASPKYLRNFTLTVTDC
YRGWNSAPGPFHLFPHTPFDPVLPSEAKFLGSGTGFRPIGGGAGGSGKEFQAALGGNVQR
EQFTVVMLTYEREEVLMNSLERLNGLPYLNKVVVVWNSPKLPSEDLLWPDIGVPIMVVRT
EKNSLNNRFLPWNEIETEAILSIDDDAHLRHDEIMFGFRVWREARDRIVGFPGRYHAWDI
PHQSWLYNSNYSCELSMVLTGAAFFHKYYAYLYSYVMPQAIRDMVDEYINCEDIAMNFLV
SHITRKPPIKVTSRWTFRCPGCPQALSHDDSHFHERHKCINFFVKVYGYMPLLYTQFRVD
SVLFKTRLPHDKTKCFKFI
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgacaggctataccatgttgcggaatgggggagtggggaacggtggtcagacctgtatg
ctgcgctggtccaatcgcatccggctgacatggctgagtttcacgctgttcatcatcctc
gtcttcttccccctcattgctcactattacctcaccactctggacgaggcagacgaggct
ggcaagcgcatcttcggccctcgggctggcagtgagctctgtgaggtaaagcacgtcctc
gatctctgtcggattcgtgagtctgtgagcgaagagcttctacagctcgaagccaagcgg
caggagctgaacagcgagattgccaagctgaacctcaagattgaagcctgtaagaagagc
atagagaatgccaagcaggacctgctgcagctcaagaatgtcattagccagacagagcac
tcctacaaggagctgatggcccagaaccagcccaaactgtccctgcccatccgactgctc
cccgagaaggacgatgccggccttccaccccccaaggtcactcggggttgccgccttcac
aactgctttgattactctcgttgtcctctgacgtctggctttcccgtctacgtctatgac
agtgaccagtttgcctttgggagctacctggaccctttggtcaagcaggcttttcaggct
acagtgagagccaacgtttatgttacagaaaatgcggccatcgcctgcctgtatgtggtg
ttagtgggagaaatgcaagagcccactgtgctgcggcctgccgaccttgaaaagcagctg
ttttctctgccacactggaggacagatgggcacaaccacgtcattatcaacctgtcccgg
aagtcagacacacagaatctactgtacaacgtcagtacaggccgggccatggtggcccag
tccaccttctatgctgcccagtacagagctggctttgacctggtcgtgtcaccccttgtc
catgctatgtctgaacccaacttcatggaaatcccaccgcaggtgccagttaagcggaaa
tatctcttcactttccagggcgagaagatcgagtctctgagatctagccttcaggaggcc
cgttccttcgaggaagagatggagggcgaccctccggccgactatgacgatcgcatcatt
gccaccctaaaggccgtacaggacagcaagctggatcaggtgctggtagaattcacttgc
aaaaaccagccgaagcccagcctgccgactgagtgggcactgtgtggggagcgggaagac
cgcctggagttactgaagctctccaccttcgccctcatcatcactcccggggacccgcac
ctgctcatttcatctgggtgtgccacgcggctcttcgaggccctggaggtgggggccgtg
ccggtggtgctcggggagcaggtgcagctcccgtaccacgacatgctgcagtggaacgag
gccgccctggtggtgcccaagcctcgcgtcacagaggtccacttcctgttacgaagtctt
tcagacagtgatctgttggccatgaggcggcaaggccgctttctctgggagacctacttc
tccaccgcagacagtatttttaataccgtgctggccatgattaggactcgaattcagatc
ccagctgctcccatccgggaagaggtagcggctgagatcccccatcgttcaggcaaagca
gctggaactgaccccaacatggctgacaatggggacctggacctggggccggtagagaca
gaaccaccctatgcctcacctaaatacctccgcaatttcactctgactgtcacagactgt
taccgtggctggaactctgccccgggacccttccatctttttccccacacaccctttgat
cctgtgttgccctctgaggccaaattcctgggctcagggactggatttcggcccatcggt
ggcggggctgggggctctggcaaggagttccaggcagcgctcggaggcaatgtccagcgg
gagcagttcacagttgtgatgctgacctacgagcgggaggaagtgctcatgaactccctg
gagagactcaacggcctcccctacctgaacaaggtagtggtggtgtggaactctcccaag
ctgccctcggaggaccttttgtggccagacattggtgtccccatcatggtcgtccgtact
gagaagaacagtttgaacaatcggttcttgccctggaatgagattgagacagaggccata
ctgtccatcgacgatgatgctcacctccgccatgatgaaatcatgtttgggtttcgggtg
tggagagaagcacgtgatcgcattgtgggtttccctggccggtaccatgcgtgggacata
ccacaccagtcctggctctacaattccaactactcctgtgagctgtccatggtgctgacg
ggcgctgccttctttcacaagtattatgcctacctgtattcttatgtgatgccccaggcc
atccgggacatggtggacgagtacatcaactgtgaggatatcgccatgaacttccttgtc
tcccacatcacacggaaaccccccatcaaggtgacatcaaggtggacttttcgatgccca
gggtgccctcaggccctgtcccatgatgactctcattttcacgagcggcacaagtgtatc
aacttttttgtcaaggtgtacggctatatgcctctcttgtacacacagttcagggtggac
tccgtgctcttcaagacccgcctgccccatgacaagaccaagtgcttcaagttcatctag

DBGET integrated database retrieval system