KEGG   Mus musculus (house mouse): 546335
Entry
546335            CDS       T01002                                 
Symbol
Gm5938, EG546335, OBP6
Name
(RefSeq) predicted gene 5938
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Lipocalin DUF883_C SpoVIF
Other DBs
NCBI-GeneID: 546335
NCBI-ProteinID: NP_001079003
MGI: 3648846
Ensembl: ENSMUSG00000079521
UniProt: A2AEN9
Position
X:77169073..77174009
AA seq 163 aa
MAKFLLLALAFGLAHAAMEGPWKTVAIAADRVDKIERGGKLRIYCRSLTCEKECKEMKVT
FYVLENGQCSLTTITGYLQEDGKTYKTQYQGDNHYELVKETPENLVFYSENVDRADRKTK
LIFVLGNKPLTSEENERLVKYAVSSHIPPENIRHVLGTDTCPE
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaaaatttctgctgcttgctttggcatttggactggcacatgctgcgatggaagga
ccttggaaaactgttgctattgctgctgatagagtagacaagatagagagaggtggaaaa
ctgagaatctattgtcgtagccttacctgtgaaaaggaatgcaaggaaatgaaagtcaca
ttttatgtacttgaaaatggacagtgctcattgaccacaatcactgggtatttgcaagaa
gatggcaagacctacaaaactcagtatcaaggggataatcattatgaacttgtgaaggag
acacctgagaacttagtattttatagtgagaatgtggacagagctgaccggaaaacaaaa
ttgatatttgttcttggcaataaacctttaacttctgaggaaaatgaaagacttgtgaaa
tatgctgtgtcaagccacattcctcctgaaaacattagacatgtcctgggtacagatacc
tgtcctgagtaa

DBGET integrated database retrieval system