KEGG   Mus musculus (house mouse): 54644
Entry
54644             CDS       T01002                                 
Symbol
Otud5, AA407879, AI553596, BB114028, DUBA, DXImx46e, Sfc7
Name
(RefSeq) OTU domain containing 5
  KO
K12655  OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    54644 (Otud5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    54644 (Otud5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    54644 (Otud5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     54644 (Otud5)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C85
   54644 (Otud5)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    54644 (Otud5)
SSDB
Motif
Pfam: OTU Peptidase_C65
Other DBs
NCBI-GeneID: 54644
NCBI-ProteinID: NP_613070
MGI: 1859615
Ensembl: ENSMUSG00000031154
UniProt: Q3U2S4
Position
X:7705852..7742865
AA seq 566 aa
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGAGVGVGGGGTGVGGGERDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAT
TAGVGAAGVVVGVGGTVGVGGCCSGPGHSKRRRQAPGVGAVGGASPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLM
KNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPS
QPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTVLALA
KPPSPCAPGTSSQFSAGGDRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASV
LAVSQQEYLDSMKKNKVHREPPPDKS
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgactattctccccaaaaagaagccgccacctcccgacgccgacccggccaacgaaccg
ccgccgcccgggccgctgcccccggcgcctcggcgcggtgcgggtgtaggcgtgggtggc
ggcggcacgggtgtgggcggaggagagcgcgaccgtgactccggcgtcgtgggggcccgt
ccccgggcttcgccgccacctcagggcccgctcccggggccgcctggtgctcttcatcgt
tgggcactggccgtgccgcctggcgcagtcgcgggccctcggccacagcaggcttctcca
cctccttgtgggggccccggtggccccggcggcggtcctggtgacgctcttggtgcgaca
actgcgggggtgggcgcggcaggggtggtggtgggcgtgggtggtaccgtgggcgtgggc
ggctgctgctcggggcccgggcacagcaagcggcggcgtcaagctcccggcgttggcgca
gttggcggggccagtccggaacgtgaagaggtcggagcgggctacaacagtgaagacgag
tatgaagctgccgcagcgcgaatcgaggccatggatcccgccactgtagaacagcaggaa
cactggtttgaaaaggccttgcgggacaagaaaggcttcatcatcaagcagatgaaggag
gacggtgcctgtctatttcgggctgtagctgaccaggtgtatggagaccaggacatgcat
gaggttgttcgaaagcattgcatggactatctgatgaagaacgctgattacttctccaac
tatgtcacagaagacttcaccacctatatcaaccggaagcggaaaaacaactgccatggc
aaccacattgaaatgcaggctatggcagagatgtacaaccgtcctgtggaggtgtatcaa
tatagcacagaacctatcaacacattccatgggatccatcaaaatgaagatgaacccatc
cgtgtcagctaccaccggaatatccactataattcagtggtgaatcctaacaaggccact
attggtgtggggctgggcctaccgtcatttaagccagggtttgcagagcagtccctgatg
aagaatgccataaagacatcagaagagtcatggattgaacagcaaatgctggaagacaag
aaacgagctacagactgggaggccacaaatgaggccatagaggagcaggtggctcgagaa
tcttaccttcagtggctgagggatcaagagaaacaggcccgccaggtccggggacccagc
cagccccggaaagccagtgccacatgcagttcagccacagcagcagcctccagtggcctg
gaggaatggactagtcggtccccacggcaacgaagttcagcctcgtcacctgagcaccct
gaactgcatgccgagctaggcattaagcccccttccccaggcactgtgttagctcttgcc
aaacctccttcaccctgtgcaccaggtacaagcagtcagttctcagcagggggtgatcgg
gccacctctcctcttgtgtccctctaccctgctctggagtgccgggccctcatccagcag
atgtccccctctgcctttggtctgaatgattgggacgatgatgagatcctagcatcggtg
ctggcagtgtcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacagagag
ccacccccagacaagagttga

DBGET integrated database retrieval system