KEGG   Mus musculus (house mouse): 54646
Entry
54646             CDS       T01002                                 
Symbol
Ppp1r3f, DXImx48e, R3F, RF3, Sfc15
Name
(RefSeq) protein phosphatase 1, regulatory subunit 3F
  KO
K17453  protein phosphatase 1 regulatory subunit 3F
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    54646 (Ppp1r3f)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    54646 (Ppp1r3f)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     54646 (Ppp1r3f)
SSDB
Motif
Pfam: CBM_21 CBM53
Other DBs
NCBI-GeneID: 54646
NCBI-ProteinID: NP_613071
MGI: 1859617
Ensembl: ENSMUSG00000039556
UniProt: Q9JIG4 B9EHL3
Position
X:complement(7424801..7440520)
AA seq 799 aa
MARTAPVEPPLRHPAPPSPAAGEPRASAEAAVAPRRVLFADEALGLPLAQLRRYRPWGGP
GAGKMAAATGQDGGGGGADEEDDGEDGDEGEEEEEAFPDPSPPCPVPAGGGFYLVPTFSL
PPALGRLERLGRVMVELEALLPPPGAVPGGSGVWVPGGRPPVVRGLVRVLNRSFEKAVHV
RASHDGWATFCDHPARYVPRSPPGAGVGGTGAGDPLLDPGLGLGPGQMSASSPDDGGCTD
RFAFQLPFAEGASDGARLDFVVRYETPEGTFWANNHGRNYTVLLRIAPAPTPTDAEGLPQ
QQQLQQLEPQPECQGPVEAEARQLKSCMKPVRRRPFEEEPRMRSADDNTLAEHPDVRESL
GPLLAPTPLRPWPQMTLQVPEVMLTSNPQEEGDIPRSNPPVAFTEVRQAPAIRILPATCG
LGGPPRDQASGPDASDRAAGSFLEPTQQQVEAAWESGGGRKAPMVGALTDEPARGLEIVS
GLDELLGEDTIDQELEQLYLSHLSRLRAVAAAGGGEGTSPTHALGILTDRDLILKWPGPE
RALNSALAEEITLHYARLGCGVELIKDTEDPDDEGEGEDGLSITPSSPEGGSPKESPPEI
LSGARSVIATMGDVWVPWAERSSSRCDSPVVLGTQGQFTENPEKGMGKDTKSLHLNRVIV
GMSKSPGEAGTESQMEELPTERESSWVPSSEKELPLPVQQEQSPALLGPTGTEVCLSSVA
KPHVNSQEEEGGSLNLESPKRSPMPAAPAECACGLAPQLWGPLTQTLGVLAGLVMVPVAL
NSGVSLLVLVLCLSLAWFS
NT seq 2400 nt   +upstreamnt  +downstreamnt
atggcgcgcacggcccctgtggagccaccgctgcggcatcccgcgcccccgtcgccggct
gcgggagagccccgcgcctcggctgaggcggcggtggccccgcggagggtgctgttcgct
gacgaggccctggggctgcctctggcgcagctacgccgctaccggccgtggggcgggccc
ggggcgggcaagatggcggcggcgaccgggcaagatggcggcggtggcggggctgatgag
gaagacgatggcgaggatggggatgaaggggaggaggaagaggaggcttttcccgatccc
tctccgccgtgccccgttcccgctggcggggggttttacctggtgcccacattttcgttg
ccgcccgcgctgggccgtctggagcggttggggcgcgtgatggtggagttggaggcgctg
ctgccgcctcctggagcggttcccgggggttccggggtgtgggtgcctgggggacgcccg
ccagtggtgcgcgggttggtgcgcgtgctgaaccgctccttcgagaaggcggtgcacgtg
cgggcctcacacgacggttgggctaccttctgcgaccacccagcccgctatgtcccacgc
agcccgcctggggcaggagtgggaggaacaggagcaggagatcccctcctggatcccggg
ctaggcctgggccctggccagatgtcagcctcctcacccgacgacggtggctgcactgac
cgctttgccttccagctgccctttgctgagggcgcgagcgatggggcgcgcctcgacttc
gtggtgcgctatgagacccccgagggcactttctgggccaacaaccatggccgcaactac
actgtcctgctccggatcgcacccgctcccacacccactgatgccgaagggctgccccag
cagcagcagctgcagcagctggagccacagcctgagtgccagggtcctgtggaggctgag
gccaggcagctgaagagctgcatgaagccggtgaggcgcaggccttttgaagaagagcca
aggatgaggagtgcggacgataataccctagcagaacatcctgatgttcgagagtcacta
ggtcccctgttggcccctacccctctccgtccatggccccagatgacacttcaggtgccc
gaagttatgttgaccagcaaccctcaagaagaaggtgacatccccagaagcaacccacct
gtggcttttacagaggtccgccaggcacctgccatcaggattcttccagcaacctgtggc
ctgggtggccccccaagggaccaggcctcagggcccgatgcaagtgatagagctgctggc
tccttcctggaacccacccagcagcaggtggaggctgcgtgggaaagtggagggggtcga
aaggcccctatggtaggggctctgacagatgagcccgccaggggtctggagattgtgagt
ggcttggatgagttgcttggtgaagacaccattgaccaggagttggagcagctctacctg
tctcacctgagccgcttgagagctgtggcagcggcgggtggcggggaaggcacttccccc
actcatgccctgggcatactcacagaccgtgacctgatcttgaagtggcctggccccgag
agggccctgaacagtgctctggccgaggagatcacgctgcactatgcgcgcctgggctgt
ggcgtggagctcatcaaggacactgaagacccagatgacgagggggagggtgaagatggg
ctctccatcactccttctagccctgaagggggcagccctaaggaatcgcctccagaaatc
ctctctggagcccgctctgtgatagctactatgggagatgtgtgggttccatgggcagag
cgctctagctctagatgtgatagcccagtggttctgggaacacagggtcagttcactgag
aatccagagaaagggatgggcaaggacaccaagtctctgcacctgaatagggtaatagtt
gggatgagcaagtcccctggggaggctgggacggaaagccagatggaggagctacctact
gagcgggaaagcagctgggtacctagttctgagaaagagctgcctctaccagtccagcaa
gagcagagtcctgccctccttggtcccacagggactgaagtctgtctgtctagtgtagcc
aagcctcatgtgaactcccaggaagaagagggtggaagcctgaatcttgagtccccaaag
aggtctcccatgccagcggcccctgcagaatgtgcgtgtgggttggctcctcagctctgg
gggcccttgacccaaactttgggtgtactggctgggctcgttatggtccccgtggctttg
aacagcggtgtgtcccttctggtgctggtgctgtgcctctctctggcctggttctcgtag

DBGET integrated database retrieval system