KEGG   Mus musculus (mouse): 54670
Entry
54670             CDS       T01002                                 

Gene name
Atp8b1, AI451886, FIC, FIC1, I, Ic
Definition
(RefSeq) ATPase, class I, type 8B, member 1
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    54670 (Atp8b1)
Enzymes [BR:mmu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     54670 (Atp8b1)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase Hydrolase E1-E2_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 54670
NCBI-ProteinID: NP_001001488
MGI: 1859665
Ensembl: ENSMUSG00000039529
UniProt: Q148W0
Position
18; 18 E1
AA seq 1251 aa
MSTERDSETTFDEESQPNDEVVPYSDDETEDELEDQGSTVEPEQNRVNREAEKKRETFRK
DCTWQVKANDRKFHEQPHFMNTKFFCIKESKYASNAIKTYKYNGFTFLPMNLFEQFKRAA
NFYFLILLILQAIPQISTLAWYTTLVPLLLVLGITAIKDLVDDVARHKMDKEINNRTCEV
IKDGRFKIIKWKDIQVGDVIRLKKNDFIPADILLLSSSEPNSLCYVETAELDGETNLKFK
MALEITDQYLQIEDNLATFDGFIECEEPNNRLDKFTGTLFWKNQSFPLDADKILLRGCVI
RNTDVCHGLVIFAGADTKIMKNSGKTRFKRTKIDYLMNYMVYTIFIVLILVSAGLAIGHA
YWEAQVGNYSWYLYDGENATPSYRGFLNFWGYIIVLNTMVPISLYVSVEVIRLGQSHFIN
WDLQMYYAEKDTPAKARTTTLNEQLGQIHYIFSDKTGTLTQNIMTFKKCCINGTIYGDHR
DASQHSHSKIELVDFSWNTFADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLSICHTVMVD
RIDGQINYQAASPDEGALVNAARNFGFAFLARTQNTITVSELGSERTYNVLAILDFNSDR
KRMSIIVRTPEGSIRLYCKGADTVIYERLHRMNPTKQETQDALDIFASETLRTLCLCYKE
IEEKEFTEWNNKFMAASVASSNRDEALDKVYEEIEKDLILLGATAIEDKLQDGVPETISK
LAKADIKIWVLTGDKKETAENIGFACELLTEDTTICYGEDINSLLHTRMENQRNRGGVSA
KFAPPVYEPFFPPGENRALIITGSWLNEILLEKKTKRSKILKLKFPRTEEERRMRSQSRR
RLEEKKEQRQKNFVDLACECSAVICCRVTPKQKAMVVDLVKRYKKAITLAIGDGANDVNM
IKTAHIGVGISGQEGMQAVMSSDYSFAQFRYLQRLLLVHGRWSYIRMCKFLRYFFYKNFA
FTLVHFWYSFFNGYSAQTAYEDWFITLYNVLYSSLPVLLMGLLDQDVSDKLSLRFPGLYV
VGQRDLLFNYKRFFVSLLHGVLTSMVLFFIPLGAYLQTVGQDGEAPSDYQSFAVTVASAL
VITVNFQIGLDTSYWTFVNAFSIFGSIALYFGIMFDFHSAGIHVLFPSAFQFTGTASNAL
RQPYIWLTIILTVAVCLLPVVAIRFLSMTIWPSESDKIQKHRKRLKAEEQWKRRQSVFRR
GVSSRRSAYAFSHQRGYADLISSGRSIRKKRSPLDAIIADGTAEYRRTVES
NT seq 3756 nt   +upstreamnt  +downstreamnt
atgagcacagaaagagactcggaaacaacatttgatgaggagtctcagcccaacgatgaa
gtggtcccctacagtgatgatgaaactgaagacgaacttgaagatcaggggtccacggtt
gaaccagaacagaatcgtgtcaacagagaagctgagaagaagagagagacattccggaaa
gattgcacgtggcaagtcaaagcaaatgaccgaaagttccacgaacaacctcatttcatg
aacaccaagttcttttgtattaaggagagcaaatatgcgagtaatgcaattaaaacatac
aagtacaatggatttacctttctacccatgaatttgtttgagcagtttaagagggcagcc
aacttctatttcctcatcctcctgatcctgcaggcaattcctcaaatctccaccctggca
tggtataccacacttgtacctctgcttttggtgctgggcatcacggccatcaaagacctg
gtagatgatgtggctcgtcataaaatggacaaggaaatcaacaataggacgtgtgaagtc
attaaggatggcaggttcaaaatcatcaagtggaaagatatccaggttggagatgtcatc
cgcctgaagaagaatgattttattccagctgacatcctgctgttgtccagttcagagcct
aacagcctctgctatgtagaaacggctgagctcgacggagaaaccaatttgaagttcaaa
atggccctggaaatcacggaccaatatctccaaatagaagataacttggcaacatttgat
ggtttcatcgaatgtgaagaaccaaacaatcggttagacaagttcacaggaacgctgttt
tggaagaaccaaagctttcctttggatgctgataaaatcctgttacgaggttgtgtgata
aggaacaccgatgtctgccatggcctggtcatttttgcaggtgctgacacaaagataatg
aagaatagtgggaaaaccagatttaaaagaaccaaaattgattacttgatgaactacatg
gtgtacacgatctttattgttctcatcctggtttctgccggcctcgccattggccacgcc
tattgggaagcccaagttggcaattattcctggtacctctatgatggagaaaatgccaca
ccgtcctaccggggattcctgaatttctggggctacatcattgtattgaacaccatggtg
cccatttctctctatgtcagtgtggaagtgatccgtctgggacagagtcatttcatcaac
tgggacctgcagatgtactatgctgagaaggacactcctgccaaggcgaggaccaccacc
ttgaatgagcagctagggcagattcattacatcttctctgataagacggggacactcacg
caaaatatcatgaccttcaaaaagtgctgcattaacgggactatctatggagaccatcga
gatgcttctcaacacagccacagcaaaatcgagctagtggactttagctggaatacattt
gccgatggaaagcttgcattttatgaccattaccttatcgagcaaatacagtcagggaaa
gagccagaagtacgacagttcttctttttgctttcgatttgccatacggtcatggtggac
agaattgatggtcagatcaactaccaggcggcttctcctgatgaaggcgccctggtaaac
gccgccaggaacttcggctttgcctttctcgcccggacgcagaacaccatcaccgtcagc
gaactgggctcagagaggacctacaacgtccttgccattttggatttcaacagcgaccga
aagcggatgtctatcatcgtgaggaccccagaaggtagtatccggctgtactgtaaaggt
gctgacaccgtgatttatgaacggctccatcggatgaatcctacgaagcaagaaacacag
gatgccctggatatctttgcaagtgagactctcaggaccctgtgcctgtgctacaaggaa
attgaagaaaaagaatttacagaatggaataataagtttatggccgccagcgtggcctca
agcaaccgagacgaagcgttggataaagtgtacgaggagattgagaaagacttgattctc
ttgggagctactgctattgaagacaagctacaggatggagtcccagaaaccatttcaaaa
cttgcaaaagctgacattaagatctgggtactcaccggagacaaaaaggaaactgcagaa
aacataggttttgcctgtgaactcttgacggaagacactactatctgctacggagaggac
ataaactctcttcttcacaccaggatggagaatcagagaaacagaggtggagtctctgcg
aaatttgcacctcctgtgtatgaacccttttttccacctggagaaaaccgtgccttaatc
atcactggctcctggctgaatgaaatccttctagagaagaagaccaagagaagtaagatc
ctgaagctgaagttcccaaggacagaggaggagaggcggatgcggagccagagccggaga
cggctggaagagaagaaagagcagcggcaaaagaacttcgtggacctggcctgcgagtgc
agcgccgtcatctgctgccgcgtcacgcccaagcagaaggccatggtggtggacctggtg
aagaggtacaagaaagccatcaccctggccatcggagacggggccaatgatgtcaacatg
atcaaaactgcccacattggtgttggaataagtggacaagaagggatgcaagctgtcatg
tccagtgactattcttttgctcagttcagatatctgcagcggttgctgctggtccacggc
cggtggtcttacataaggatgtgcaagttcctacgatacttcttttacaagaactttgcc
tttactttagttcatttctggtactccttcttcaatggctactcagcccagacggcgtat
gaggattggtttatcaccctctacaacgtgctgtactccagtttgcctgtgctcctcatg
gggctgctggatcaggacgtgagtgacaagctgagcctccgattccctgggctgtatgta
gtggggcagagggacttgctgttcaactataagagattctttgtcagtttgctgcatggg
gtcttaacctcaatggtcctcttcttcataccgcttggtgcttatctgcaaacagtggga
caggatggggaggcgccttcagactaccagtccttcgccgtcacggtggcctccgctcta
gtgataacggtcaacttccagattggcttggatacttcatactggacttttgtgaatgcc
ttttcaattttcggcagcatcgcactgtacttcggcatcatgtttgatttccacagtgct
gggatacacgttctctttccgtccgcatttcagttcacaggtacagcttccaatgccctg
agacagccatacatctggctgaccatcatcctgacggttgccgtgtgcttactacctgtc
gtcgccatccgtttcctgtccatgaccatttggccctcagaaagtgataagatccagaag
catcgaaagcgattgaaggctgaagagcagtggaaacggcggcagagcgtgttccggagg
ggagtatcttccaggcgctcagcctatgccttttcgcatcagagaggctacgcagacctc
atctcctctggccgcagcatccgcaagaagcgctcgcccctggatgccatcatcgcggat
ggcacggctgagtaccggcgcacagtggagagctga

DBGET integrated database retrieval system