KEGG   Mus musculus (mouse): 54683
Entry
54683             CDS       T01002                                 

Gene name
Prdx5, AOEB1, AOEB166, AOPP, P, PLP, PMP, Pmp20, Prd, Prdx6, PrxV
Definition
(RefSeq) peroxiredoxin 5
  KO
K11187  peroxiredoxin 5 [EC:1.11.1.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    54683 (Prdx5)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     54683 (Prdx5)
SSDB
Motif
Pfam: Redoxin AhpC-TSA
Other DBs
NCBI-GeneID: 54683
NCBI-ProteinID: NP_036151
MGI: 1859821
Ensembl: ENSMUSG00000024953
Vega: OTTMUSG00000021180
UniProt: P99029
Position
19 A; 19 5.08 cM
AA seq 210 aa
MLQLGLRVLGCKASSVLRASTCLAGRAGRKEAGWECGGARSFSSSAVTMAPIKVGDAIPS
VEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVA
CLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMV
IDNGIVKALNVEPDGTGLTCSLAPNILSQL
NT seq 633 nt   +upstreamnt  +downstreamnt
atgctacagctggggcttcgagtcctgggctgcaaagccagttctgtgctccgtgcatcg
acgtgcttggcaggcagagcaggccggaaagaagcaggttgggagtgtggcggagcccgc
agcttcagcagctccgcggtgaccatggccccgatcaaggtgggagatgccattccctca
gtggaggtatttgaaggggaaccgggaaagaaggtgaacttggcagagctgttcaagggc
aagaaaggtgttttgtttggagtccctggggcatttacacctggctgttctaagacccac
ctgcctgggtttgtggagcaagctggagctctgaaggccaagggagcgcaggtggtggcc
tgtctgagcgttaatgacgtctttgtgattgaagagtggggtcgagcccaccaggcagaa
ggcaaggttcggctcctggctgaccccactggagcctttgggaaggcgacagacttatta
ttggatgattctttggtgtctctctttgggaatcgtcggctgaaaaggttctccatggtg
atagacaacggcatagtgaaggcactgaacgtggagccagatggcacaggcctcacctgc
agcctggcccccaacatcctctctcaactctga

DBGET integrated database retrieval system