KEGG   Mus musculus (mouse): 546849Help
Entry
546849            CDS       T01002                                 

Gene name
AAdacl4fm3, Gm13178, Gm437
Definition
(RefSeq) AADACL4 family member 3
  KO
K14351  arylacetamide deacetylase-like 3/4 [EC:3.1.1.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    546849 (AAdacl4fm3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     546849 (AAdacl4fm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9 Pox_D5
Motif
Other DBs
NCBI-GeneID: 546849
NCBI-ProteinID: NP_001079005
MGI: 3650721
Ensembl: ENSMUSG00000041735
Vega: OTTMUSG00000010750
UniProt: B1AVU7
Position
4; 4 E1
AA seq 408 aa AA seqDB search
MAGFWLVLIGGLLTFFLGVFVWVFIQHLLTIEIPSTLKHPVKLWILHLIFQYLITLGTIL
EKLRICSMPAILQFFQDLIIIKKKVPNVIVTDTRFGTVPVRLFRPKEVSSKPRRGIIFYH
GGGAVCGSLDFYHGLGNVLAHETDSVVLLVGYRKLPDHHHPVVYLDCLNASIHFLKNLQT
YGVDPSRVVISGESIGGWTVATVTQALVSQAILPQIRAQVLITPGLQGINFQLPSHQQKQ
NVPLLTRDLVITFVCRYLSIDLSWKNAIVTGAFVPLDTWKKYSKWLSSDNIPKRFKSKKF
HPEFLGPFSETAYLETKHVFDVNISPLLADDKIIAQLPDTFLVSCEHDVLRDDALLYKKR
LEDQGVPVSWYHAEDGFHGCISLFDKQPFSFPCSMNVLNAVISYIKDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctggtttttggctggtgctgataggagggctgctcacattcttcctgggagtcttt
gtatgggttttcatccagcaccttctcactattgaaattccatctaccctgaagcatcca
gtcaagctatggattttgcatttgattttccagtatttgataactttggggaccatacta
gagaaactgagaatttgttccatgcctgcaattttacagttttttcaagacctaataata
ataaaaaagaaagttccaaatgtgatagtgactgacacacgttttgggacggtacctgtg
aggctgttcaggcccaaagaggtgtcttccaaaccccggagaggcatcatattctaccat
ggaggaggtgccgtatgtggaagtctggacttttaccatggcctgggcaatgtccttgcc
catgagacagactcagtggtcttgttggtggggtaccgcaagcttcctgaccaccatcat
cctgttgtttacctggattgcctgaatgcttccatccacttcctgaagaaccttcaaacc
tatggggtagatccctctcgggtggtgatctctggagaaagtattggaggttggactgtg
gccactgtcactcaggctttggtcagtcaagccatacttccccagatcagggctcaagtg
ctgattactccaggtttgcagggcattaatttccagttaccatcacaccagcagaaacaa
aatgtcccattgcttaccagagacttagtgattacatttgtttgtagatacctaagcatt
gacctctcttggaaaaatgccatagtgacaggagcttttgtgcccctggacacctggaaa
aagtacagcaagtggctcagctctgacaatattcccaaaaggtttaagagcaaaaaattc
catcccgagtttctgggacctttcagtgagactgcctatctagaaacgaagcatgttttc
gatgtaaacatctcacctctcctagcagatgacaagatcattgctcaacttccagacaca
tttctggtgagctgtgagcatgatgttctccgggatgatgccttgctctacaagaagcgc
ttggaagaccagggggttcctgtgtcctggtaccatgcggaggatggctttcatggctgc
atcagtttgtttgataagcagcctttctctttcccctgctccatgaatgttttaaatgct
gtcatcagttacattaaggatgtataa

DBGET integrated database retrieval system