KEGG   Mus musculus (mouse): 54709Help
Entry
54709             CDS       T01002                                 

Gene name
Eif3i, 36kDa, D4Ertd632e, Eif3s2, Trip1
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit I
  KO
K03246  translation initiation factor 3 subunit I
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    54709 (Eif3i)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    54709 (Eif3i)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    54709 (Eif3i)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 54709
NCBI-ProteinID: NP_061269
MGI: 1860763
Ensembl: ENSMUSG00000028798
Vega: OTTMUSG00000009520
UniProt: Q9QZD9
Position
4 D2.2; 4 63.26 cM
AA seq 325 aa AA seqDB search
MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA
DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC
FVSFFDLRDPSQIDSNEPYMKIPCNDSKITSAVWGPLGECVIAGHESGELNQYSAKSGEV
LVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPN
YDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY
SSGGEDGYVRIHYFDPQYFEFEFEA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatcctgctgcagggccatgagcggtccatcacgcagatcaagtataaccgc
gaaggagaccttctcttcaccgtggccaaagaccctatcgtcaacgtgtggtactctgtc
aatggggagaggctaggcacctacatgggccacactggagctgtgtggtgcgtggatgct
gactgggacaccaagcatgtccttactggctcagctgacaacagctgtcgtctctgggac
tgtgaaacagggaagcagctggccctactcaagaccaactcagctgtccggacctgcggc
tttgactttgggggcaacatcatcatgttctccacagacaagcagatggggtatcagtgc
ttcgtgagcttctttgatctgcgggatccaagccagatcgacagcaacgagccctacatg
aagatcccctgtaatgattccaagatcaccagtgccgtctggggccccctcggggagtgc
gtcatcgcaggccacgagagcggagagctcaaccagtatagcgccaagtctggagaggtg
ttggtgaacgtaaaggaacactctcggcagatcaatgacatccagttgtctagagacatg
accatgtttgtcactgcatctaaggacaacacagctaagctcttcgactccacgactctt
gaacatcagaagactttccgaacagagcgtcctgtcaactcggctgctctctctcccaac
tatgaccatgtggtgctgggaggaggtcaggaagccatggatgtgaccacaacctccacc
aggattggcaagtttgaggccaggttcttccatttggcttttgaggaagagtttggaaga
gtcaagggccactttggaccgatcaacagcgttgccttccatcctgatggcaagagctac
agcagcggtggcgaagatggttacgtccgcatccactacttcgacccacagtactttgag
ttcgagtttgaggcctaa

DBGET integrated database retrieval system