KEGG   Mus musculus (mouse): 54712
Entry
54712             CDS       T01002                                 

Symbol
Plxnc1, 2510048K12Rik, AW742158, CD232, Vespr
Name
(RefSeq) plexin C1
  KO
K06572  plexin C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    54712 (Plxnc1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    54712 (Plxnc1)
CD molecules [BR:mmu04090]
 Proteins
  54712 (Plxnc1)
SSDB
Motif
Pfam: Plexin_cytopl Plexin_RBD PSI TIG Sema PSI_integrin DUF6018 TRP
Other DBs
NCBI-GeneID: 54712
NCBI-ProteinID: NP_061267
MGI: 1890127
Ensembl: ENSMUSG00000074785
Vega: OTTMUSG00000042667
UniProt: Q9QZC2 Q9CRY9
Position
10:complement(94626728..94780875)
AA seq 1574 aa
MEVSRRKTPPRPPYPAAPLPLIAYLLALAAPARGADEPVWRSEQAIGAIAASRADGVFVA
SGSCLDQLDYSLKNRLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKLLLPYREGATGLE
GLLLTGWTFDRGACEVRPLGNLNRSSLRNGTEVVSCHPQGSTAGVVYRASGTDLWYLAVA
ATYVLPEPETANRCNPAASDRDTAIALKNTEGRSLATQELGRLKLRGSAGSLHFVDAFLW
NGSVYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQAALDCDHGHPEGRRLLLSSSLV
EAVDIWAGVFSAATGEGQERRSPATTALCLFRMSEIQAHARSCSWDFQATEHNCKEGDRP
ERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVVLGENLTSNCPEVIYEIK
EETPVFYKLVPHPMKNIYIYLTAGKEVRRIPVANCSKRKSCSECLAAADPHCGWCLPLQR
CTFQGDCTHAGSFENWLDISSGPKKCPKIQILRSLRERTTVTIVGSISARHSECVVKNAD
TGKLLCQGRSQLNWTCACNIPSRPSYNVLVVNATFSFPSWNLSERFNFTNCASLKECPAC
IRSGCAWCKRDKKCIHPFTPCEPSDYERNQELCQVAVEKSPKDSGGGRVKESKRNRTDGA
VQVFYIKAIEPQKISTLGKSNVIVTGANFTQASNITMILRGTSTCERDVIRVSHVLNDTH
MKFSLPSSRKEMKDVCIQFDGGTCSSAGALSYIALPHCSLIVPATTWISGGQNITIMGRN
FDVIDNLIISHELKGNANVNINVSEYCAATFCRFLAPNLKSSKVRTNVAVKLRVQDTYLD
CGTLQYLEDPRFTGYRVESEIDTELEVKIQKENDNFNISKDDIDITLFHGENKQFNCSFE
NITRNQDLTTILCKIKSIKNANTIASSSKKVRVKLGNLELYVEQESVPSTWYFLIALPIL
LAIVIVVAVVVTRYKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVP
FLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLE
KQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVE
KLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVP
EFNTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKVFQAFLSKNGSPYGLQLN
EIGLELQVGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVE
YSDDHCHLILPDSEAFQVVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWS
LPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKK
TPHIDSCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPP
LSSLEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEEAQKQLLH
VKVLFDEKKKCKWM
NT seq 4725 nt   +upstreamnt  +downstreamnt
atggaggtctcccggaggaagacgccgccgcgccccccgtaccccgccgcaccgttgccc
ctgatcgcctatctgctggcgctggcagcgcccgcccggggcgcggacgagccggtgtgg
cgatctgagcaagccatcggagccatcgcggcgagccgggcggacggcgtgttcgtggcg
agcggcagctgcctggaccagctggactacagcctgaagaacaggctctctcgcctatac
cgggaccaagcgggcaactgcacggagcccgtctcgttggcgccccccgcgcggccccgg
cccgggagcagcttcagcaagctactgctgccctaccgcgagggggcgaccggcctcgag
gggctgctgctcaccggctggaccttcgaccggggcgcctgcgaggtgcggcccctgggc
aacctgaaccgcagctccctgcgcaacggcaccgaggtggtgtcatgtcacccgcagggt
tcgacggctggtgtggtgtaccgcgcgagtggcaccgacctctggtacctggcggtggcc
gccacctatgtgctgccggagccggagaccgcgaaccgctgcaaccccgcagcatccgat
cgcgacacggctatcgcgctcaagaacacggaggggcgcagtctggccacgcaggagctg
ggccgcctgaaactgcgcggtagtgcgggcagcctgcacttcgtggacgcctttctctgg
aacggcagtgtctacttcccctactatccctacaactacacgagtggcgctgccaccggc
tggcccagcatggcgcgcatcgcgcagagcacagaggtgctgttccagggccaggctgcc
ctcgactgcgaccacggccaccctgagggccgccgcctactgctttcctccagcctggtg
gaggctgtggacatctgggccggcgtgttcagcgcggccactggagagggccaggagagg
cgctcccccgccaccacggctctctgcctcttcaggatgagtgagatccaggcgcacgcc
aggagctgcagctgggactttcaagcgactgagcacaactgcaaagaaggggatcggcct
gaacgggtccagccaattgcatcgtctacactgatccactctgacctgacgtctgtttat
ggcaccgtggtgatgaacaggactgttctgttcttggggaccggagatggccagttactg
aaggttgttcttggtgagaatttgacttcaaactgtccagaggttatttatgaaattaaa
gaagaaacgcctgtgttctacaagctcgttcctcatcccatgaagaacatctacatctac
ctaacagctgggaaggaggtgagaagaattcctgttgcaaactgcagtaaacggaaatcc
tgttcagagtgcttagcagcggcagacccccactgtggctggtgcctcccgttacaaagg
tgcacttttcaaggggattgcacacatgctgggagctttgaaaactggctggatatttca
tcaggacctaaaaaatgcccgaaaattcagatacttcgaagcctccgagagagaaccaca
gtgaccattgtgggaagcatctccgcaagacactcggagtgcgtggtgaagaacgcagac
acgggcaagctgctctgccaggggagaagccaactgaactggacctgtgcctgcaatatc
cccagcagacccagctataatgtcttagttgtcaatgcgaccttctcctttccgtcttgg
aacttatcagaaagattcaacttcaccaactgtgcgtcattaaaagaatgcccggcgtgt
atcagaagcggctgtgcttggtgtaaacgggacaagaaatgcatccaccccttcaccccc
tgcgaaccatcagactatgagaggaatcaggagctctgtcaagttgctgtggagaagtcg
cccaaggactcaggaggaggaagagtcaaggagagcaagagaaacagaactgacggggct
gtgcaggtcttctacattaaggccattgagccacaaaaaatatcaaccttagggaaaagc
aatgtgattgttactggagcaaacttcacccaggcgtcaaatatcaccatgatcctgcga
ggaaccagtacctgcgagagggatgtgatccgggttagccatgtgctaaatgacacgcat
atgaaattctcacttccatcaagccgcaaagaaatgaaagacgtttgcatccagtttgac
ggtgggacctgctcgtctgcaggggctctgtcctacattgctctgccacattgttccctg
atagttcctgccaccacctggatcagcggtgggcaaaacataaccatcatgggcagaaat
tttgacgtcatcgacaacctcatcatttcacacgagctgaagggaaacgcaaatgtgaac
ataaatgtctctgaatactgcgcagcaactttctgcaggtttctagctcctaatttaaag
agctccaaagtacgtacaaacgtggccgtgaagctgagggtccaagacacctacttggac
tgtggaacgctgcaatacctcgaggaccccagatttacagggtaccgagtggagtcagag
attgatacagaattggaagtaaaaattcaaaaagaaaatgacaatttcaacatttccaag
gatgacattgatattactctcttccatggggaaaataaacaatttaattgcagttttgaa
aatattactagaaaccaggatctcacaaccatcctttgcaagatcaagagtatcaagaat
gcaaacaccatcgctagctcctctaaaaaagtccgcgtcaagctgggaaacctggaactc
tatgtggaacaggaatcagttccttccacgtggtattttctaatcgcgcttccaatcttg
ctggccattgtcatcgttgtggctgtggtggtgacgaggtacaaatccaaggagctcagt
cgaaagcagagccaacagctggagctgctggagagcgaactccggaaggagatccgcgac
ggctttgccgagctccagatggataagttggatgtggttgatagctttggaacagtaccc
ttccttgactacaaacatttcgctctgagaactttcttccctgagtcaggtggcttcacg
cacatcttcactgaagatatgcacaacagagacgccaatgacaagaacgagagcctcaca
gccttggatgccctcatatgtaataaaagcttcctggttaccgtcatccataccctggag
aagcagaagaacttctcagtaaaggacaggtgtctcttcgcctccttcctaaccattgct
ctgcaaaccaaactggtctacctgaccagcatcctggaggtgctgaccagggacctgatg
gagcagtgcagtaatatgcaaccaaagctgatgctgaggcgcacggagtctgtggtggag
aagctcctgacgaactggatgtctgtctgtctctccggtttcctccgggagactgttgga
gagccattctatttgctggtgacgaccctgaaccagaaaataaacaagggtcccgtggac
gtgatcacctgcaaagcgctgtacaccctgaacgaagactggctactctggcaggtcccc
gaattcaacactgtggcattaaatgtcgtctttgaaaaaatcccggaaaacgagagtgca
gatgtctgccggaatatttcagtcaacgttcttgactgcgataccataggccaagccaaa
gaaaaggttttccaagccttcctaagcaaaaatggttctccatacggactccagctcaat
gagattggtcttgagcttcaggtgggaacacggcagaaagaactcctggacattgacagt
tcctctgtgattcttgaagatggaataaccaagctaaacaccattggccactatgagata
tcaaatggatccactataaaagtctttaagaagatagcaaattttacttcagatgtggag
tactcagatgaccactgccacttgattctgccagattcagaagcattccaagtagttcaa
gggaagagacatcgagggaaacacaagttcaaagtaaaagaaatgtatctgaccaagctg
ctgtcgaccaaggtggcaattcactctgtgcttgagaaactcttccgaagcatttggagt
ttgcccaatagcagggccccatttgctataaaatacttctttgactttctggatgcccaa
gctgaaaacaaaaaaatcacagaccctgatgttgtacacatctggaaaacaaacagcctc
cctcttcgattctgggtaaacatcctgaagaaccctcagtttgtctttgacattaagaag
acaccacacatagacagctgtttgtcagtgattgcccaagcattcatggatgccttttct
ctcacagaacagcaactggggaaggaagcaccaaccaataaacttctctatgccaaggat
ataccaacctacaaagaggaagtgaagtcttactacaaagcaatcagggatttgcctcca
ttgtcatctttagaaatggaagaattcttaactcaggaatctaagaaacatgaaaatgaa
tttaatgaagaagtggccttgacagaaatctacaaatacatcgtaaagtattttgatgag
attctaaataaactagaaagagaacgagggctggaagaagctcagaaacaactcttgcat
gtaaaagtcttatttgatgaaaagaagaaatgcaagtggatgtaa

DBGET integrated database retrieval system