KEGG   Mus musculus (mouse): 54720
Entry
54720             CDS       T01002                                 

Gene name
Rcan1, ADAP, Adapt78, CALP1L, CS, CSP1, DSC1, Dsc, Dscr1, MCI, MCIP1, RCN1
Definition
(RefSeq) regulator of calcineurin 1
  KO
K17901  calcipressin-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    54720 (Rcan1)
   04919 Thyroid hormone signaling pathway
    54720 (Rcan1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    54720 (Rcan1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    54720 (Rcan1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    54720 (Rcan1)
SSDB
Motif
Pfam: Calcipressin GOLD_2
Other DBs
NCBI-GeneID: 54720
NCBI-ProteinID: NP_001075018
MGI: 1890564
Ensembl: ENSMUSG00000022951
UniProt: Q9JHG6
Structure
PDB: 
1WEY

Position
16 C4; 16 53.6 cM
AA seq 251 aa
MEDGVAGPRLGEVAEAVEARAPRRVTLRPFAPFSAAAEGDGGGGGDWSFIDCEMEEVDLQ
DLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDTTFQYFKSFKRVRINFSNPLSAADA
RLRLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVI
NYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQENEEEEEEMERMKRPKPKIIQT
RRPEYTPIHLS
NT seq 756 nt   +upstreamnt  +downstreamnt
atggaggacggcgtggccgggccgcggctcggagaggtggcggaggcggtcgaggcacgg
gcgccccgtagggtgactctgcggcccttcgcgcccttctctgcggctgccgagggggac
gggggcggcggcggcgactggagcttcatcgactgcgagatggaggaggtggatctgcag
gacctgccgagcgccaccatcgcctgccacctggacccgcgcgtgttcgtggacggcctg
tgccgggccaaatttgaatccctcttcagaacatatgacaaggacaccaccttccagtat
tttaagagcttcaaacgtgtccggataaacttcagcaaccccttatctgcagccgatgcc
aggctgcggctgcacaagaccgagttcctggggaaggaaatgaagttgtattttgctcag
actttacacataggaagttcacacctggctccgcccaatcccgacaaacagttcctcatc
tcccctccggcctctcctcccgttggctggaaacaagtagaagatgccacccccgtcata
aattacgatcttttatatgccatctccaagctggggccaggagagaagtatgaactgcat
gcagcgacagacaccactcccagtgtggtggtccacgtgtgtgagagtgaccaagagaat
gaggaggaagaggaagagatggagagaatgaagagacccaagcccaaaatcatccagaca
cggagaccggagtacacacccatccacctcagctga

DBGET integrated database retrieval system