KEGG   Mus musculus (mouse): 54721
Entry
54721             CDS       T01002                                 

Gene name
Tyk2, JTK1
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04621  NOD-like receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05145  Toxoplasmosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    54721 (Tyk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    54721 (Tyk2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    54721 (Tyk2)
   04658 Th1 and Th2 cell differentiation
    54721 (Tyk2)
   04659 Th17 cell differentiation
    54721 (Tyk2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    54721 (Tyk2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    54721 (Tyk2)
   05160 Hepatitis C
    54721 (Tyk2)
   05171 Coronavirus disease - COVID-19
    54721 (Tyk2)
   05164 Influenza A
    54721 (Tyk2)
   05162 Measles
    54721 (Tyk2)
   05168 Herpes simplex virus 1 infection
    54721 (Tyk2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    54721 (Tyk2)
   05169 Epstein-Barr virus infection
    54721 (Tyk2)
   05165 Human papillomavirus infection
    54721 (Tyk2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    54721 (Tyk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    54721 (Tyk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     54721 (Tyk2)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   54721 (Tyk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 54721
NCBI-ProteinID: NP_061263
MGI: 1929470
Ensembl: ENSMUSG00000032175
Vega: OTTMUSG00000063155
UniProt: Q9R117
Structure
PDB: 
4E1Z 4E20

Position
9; 9 A3
AA seq 1184 aa
MVGTMPLCGRRAILEDSKADGTEAQPLVPTGCLMVLLHWPGPEGGEPWVTFSQTSLTAEE
VCIHIAHKVGITPPCLNLFALYNAQAKVWLPPNHILDTSQDMNLYFRMRFYFRNWHGMNP
QEPAVYRCGFPGAETSSDRAEQGVQLLDSASFEYLFEQGKHEFMNDVVSLRDLSSEEEIH
HFKNESLGMAFLHLCHLALSRGVPLEEMAREISFKNCIPHSFRQHIRQHNVLTRLRLHRV
FRRFLRAFRPGHLSQQVVMVKYLATLERLAPRFGSERIPVCHLEVLAQPERDPCYIQNSG
QTAGDPGPELPSGPPTHEVLVTGTGGIQWHPLQTQESERGNSRGNPHGSRSGKKPKAPKA
GEHLTESPQEPPWTYFCDFQDISHVVLKERRVHIHLQDNKCLLLCLCSQAEALSFVALVD
GYFRLTADSSHYLCHEVAPPRLVTSIQNGIHGPLMDPFVQAKLWPEDGLYLIQWSTSHLH
RLILTVAHRNPAFSNGPRGLRLRKFPITQQPGAFVLDGWGRSFASLGDLRLALQGCSLRA
GDDCFPLHHCCLPRPREISNLVIMRGSRAHTRPLNLSQLSFHRVHQDEITQLSHLGQGTR
TNVYEGLLRVGGPDEGKVDNGCPPEPGGTSGQQLRVVLKVLDPSHHDIALAFYETASLMS
QVSHMHLAFLHGVCVRGSENIIVTEFVEHGPLDVWLRRQRGQVPMTWKMVVAQQLASALS
YLEDKNLVHGNVCGRNILLARLGLEEGTNPFIKLSDPGVGQGALSREERVERIPWTAPEC
LSGGTSSLGTATDMWGFGATLLEICFDGEAPLQGRGPSEKERFYTKKHQLPEPSSPELAT
LTRQCLTYEPAQRPSFRTILRDLTRLQPQNLVGTSAVNSDSPASDPTVFHKRYLKKIRDL
GEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVKYK
GCCEDQGEKSVQLVMEYVPLGSLRDYLPRHCVGLAQLLLFAQQICEGMAYLHAQHYIHRD
LAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASD
VWSFGVTLYELLTYCDSNQSPHMKFTELIGHTQGQMTVLRLTELLERGERLPRPDRCPCE
IYHLMKNCWETEASFRPTFQNLVPILQTAQEKYQGQVPSVFSVC
NT seq 3555 nt   +upstreamnt  +downstreamnt
atggtggggaccatgcctctgtgtgggcggagagccatcttggaagacagcaaggcagat
ggcacagaagctcagcccctggtgcccacaggatgcttgatggtgctactgcattggcct
gggcctgagggcggggagccctgggtcaccttcagccagacatctctgactgcagaggag
gtctgcatccacatcgcacacaaagtcggcatcactccaccctgcttgaatctcttcgca
ctctacaatgcacaggctaaggtctggctgcccccaaaccatattctggatacatcccaa
gacatgaacctctattttcgaatgaggttttacttccggaactggcatggcatgaatccc
caggagccagctgtataccggtgtggtttcccaggggcagagacttcctcagaccgggca
gagcaaggtgtacagctcttggactctgcctcgtttgaatacctttttgagcagggaaag
catgagttcatgaacgatgtggtgtctctgcgggacctgtctagcgaggaggagatccac
cactttaagaatgagagcttaggcatggccttcctgcacctgtgtcaccttgctctcagc
cgaggcgtccccctggaggagatggccagagagatcagcttcaagaactgcatccctcat
tccttccgacagcacatccggcagcacaatgtgctcacacgcctgcggctccacagagtc
ttccgccgcttcctgcgggccttccggcctggccacctctcccagcaggttgtgatggtg
aagtacttggctaccctggagcggctggctccgcgctttggctcagagcgcatacctgtg
tgtcatctggaggtcctggcacagcccgagagggacccctgctacatccagaacagtggg
cagaccgctggggatccaggcccagagctgccttccgggcctcccacccacgaggtactg
gtgacaggcaccggaggtatccagtggcatccgctgcagacccaggaatctgagagaggt
aacagcagagggaatccccacggcagccggtcggggaagaagcccaaagcccccaaggct
ggagagcacctgacagagagccctcaggaaccaccttggacctacttctgtgacttccag
gacatttcccacgtggtgctaaaggagcgtcgcgtgcacatccacctccaagacaacaag
tgcttgttgctgtgcctctgttcccaggctgaggccctgtcctttgtggccctggtcgat
ggctatttccgcttgactgctgactccagccactatctgtgccatgaggtggcacccccg
aggctggtgactagcatccagaacggcatccatgggcccctgatggatccgtttgtacag
gccaagctgtggccagaggacggcctctacctgattcagtggagcaccagccacctgcac
cgcctgatccttaccgtggcccatcgaaacccggctttcagtaatggccctcggggcctg
cgcctgcgaaagttccccatcacacagcagcctggagcctttgtgctggatggctggggc
cgctcctttgccagcttgggggaccttcggctcgccttgcagggctgctcgttgcgggcc
ggtgatgactgtttccccctgcaccactgctgcctgccccggccaagagaaatctccaac
ctcgtcatcatgcgggggtctagggcccacacccggcctctcaacctcagtcagctcagc
ttccacagggttcaccaggatgaaatcacccagctgtcccacttgggccaaggcacaagg
accaatgtgtatgagggccttctaagagtgggaggccccgatgagggcaaagtggacaat
ggatgtccccctgagcctggtgggactagtgggcagcagcttcgagtggtgctcaaagtt
ctcgaccccagtcaccatgatatcgccttggccttctatgagactgctagcctcatgagc
caggtgtcacacatgcacctggctttcctgcatggtgtttgcgtgcgtggctcagagaat
atcattgtgacagaattcgtagaacatggtcccttggatgtgtggttacggcgacagagg
ggccaagtgcccatgacctggaagatggtcgtggctcagcagctggccagcgccctcagc
tacctggaggacaagaatctggttcacgggaatgtatgtggccggaacatcctgctggct
cgcctggggttggaggagggtaccaaccccttcatcaagctaagtgatcctggtgtgggc
cagggtgccctctccagggaagagcgggtggagcgcatcccctggacagctcccgagtgc
ctgtctggagggaccagtagcttgggtactgccacggacatgtggggctttggtgccacc
cttcttgagatctgctttgatggggaggcacccctgcagggtcgtggtccctctgagaaa
gaacggttctacacaaagaaacatcagctgcctgaaccctcatccccagagctggccaca
ctcacccgccagtgcctgacctatgaaccagcacagcggccatccttccgcaccattttg
cgggacctcacaaggctgcagccacagaatctagtcggcacttcggctgtgaactcagac
tcaccagcatcagaccccactgttttccacaagcgctatttgaaaaagatccgggatttg
ggtgagggtcactttggcaaggtcagcctgtactgctacgacccaaccaatgacggcact
ggcgagatggtggccgtgaaggccctgaaggaagggtgcggtccccagctccgctcaggc
tggcagcgggagatcgagatcctgcggacgctgtaccacgaacatattgtcaagtataaa
ggctgctgtgaggaccaaggagagaagtctgtacagctggtcatggagtacgtccctctg
ggcagcctccgagactacctgccaaggcactgcgtagggctggcgcagctcctgctgttt
gcccagcagatctgcgagggcatggcctacctgcacgctcagcactacattcaccgagac
ctcgccgcgcgcaacgtgctgctggacaacgacaggctggtcaagattggagactttggc
ctagccaaggctgtacctgaaggccacgagtactaccgagtgcgcgaggacggggacagc
ccagtgttctggtatgccccagaatgcctgaaggagtgcaaattttactatgcatctgat
gtctggtccttcggggtaactctgtatgagttgttgacatactgtgactctaaccagagt
ccccatatgaaattcaccgagctcatcggccatacccagggccagatgaccgtgctgagg
ctcacagagctgctggaacgaggagagaggctgcctcggcctgacaggtgtccctgtgag
atctatcacctcatgaagaactgctgggagacagaggcctccttccggcccaccttccag
aatcttgtgcccatcctccagacagcacaggagaagtaccaaggtcaggtgccttccgtg
ttcagcgtgtgctga

DBGET integrated database retrieval system