KEGG   Mus musculus (mouse): 547253Help
Entry
547253            CDS       T01002                                 

Gene name
Parp14, 1600029O10Rik, ARTD8, BC021340, CoaSt6, mKIAA1268
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 14
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    547253 (Parp14)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     547253 (Parp14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP WWE Nudix_N
Motif
Other DBs
NCBI-GeneID: 547253
NCBI-ProteinID: NP_001034619
MGI: 1919489
Ensembl: ENSMUSG00000034422
Vega: OTTMUSG00000027273
UniProt: Q2EMV9
Structure
PDB: 

Position
16; 16 B3
AA seq 1817 aa AA seqDB search
MAASGSFPLLVEGSWGPDPPKNLINKLQVYFQSRKKSGGGECEVVPEPGNPARFRVLFSP
EDVRQNVLERGNHELVWQEKGTFKLTVLMPTDPEEASASKKSRKESPEEESKTKEDAVKQ
GDLDITHSPSSGSEKTEDVPKECENISSMVAFENLPEKVSEMVLTILVENISGLPSDDFK
VEVNRDFAVAVVTFQKPIDIKKFIVDCISHRSNQQLQLAPRLLETTNVVRVENLPPGVDE
YQLQLFFENPFNGGGRVARVECFPEESSALVEFCDSKVLDTVMAKTHSYNKMPLSVFPYY
PSLGTALYGEEKPLIKLPASFQESLDLPLWKFFQKNNHLIEEINNEMRCCHCELTWSEIN
GKLTIRPAATLVNHRLSIKTWQRDASAVLSGIKSKYGVELFEVCSPVWDIIKHELESGDD
RVLVEFEKESLNIAGKSEDVQGMSQKIRELIESTTEKLRREEQSLKEKVAISPGKHYLLH
HSGFLKDLSKGFPEMEISYDATAQFLYLKGFRADVYKVKCDIQEKVFSMAQKDVQVSSEV
FEFLQQVDSQRLSKSLFEAQNILAIYELKGTALFLVGSSFKDLAEAETKMLSALSHKQIE
VEDKEVLISNGWKKKVHPLQKRHSSCATIIVQNELTSETPAKVIVTGCVKEVNEIHRQLF
EYLENNMKVERALKIKPSLIVDYLRTDKRLLSKIKKAHVYVHFKPKDNPNSILLTGCKSK
VLECMNLVKEIQDSVCVQRFQTDKAGVRHFFKDKESYYKTEIGRQFGCVIELEEDREEKG
EEEDGEEEEGEEEGESSINEQKCHLQRDIAPGVKLFVLEEDLSRFPVDVVVNAANENLKH
ISGLAQALSKAAGPELQTECDQIVKEGGVVLPGNAVISKAGKLPCHHVIHAVGPRWKGDK
VLECVSLLKKVVRQSLSLAEEHRCRSIAMPAVSAGIFDFPLELCVANIVSAIKEHFQHKR
DTHTLKKIYLVGLPAKVARAFAEAVKTTYKDSLSHTAFPSSLKALVPLGKTPQKQGSLLV
SPEGLRIRLVEEGVQNATTHAIVNSISPDLKLNKGPLSQAFLEKAGPKLQEELTRSGQGV
SVDVGTILQTSGCNLNSRHVFHVVPPPWKSNNSAWSLKIMKNIIRDCLKTTENLSLQSIA
FPAIGTGNLRFPKPEFAKLIISEVLKFSSRNQLKTLQEVQFLLHPKDHENIQAFSDEFDK
RNNGDPSDKNPKAEDTQGIYGSLSSPTLGMHEMNIGPILFQVATGNIIKEVADVIVNSTT
LTFDLKSGVSKAILEGAGQNVEQECSLLAKQSNHGYIVTGGGLLQCKNIIHVVGGNDVKK
SVSCVLEECEQRNYSSICLPAIGTGNAQQDPNVVAKAIIDAIEEFVQKKSVQAVKRVKVV
IFQPHILQFFYDNMKEREGSPAPPKQSPAKQSVMSKIASFLGFPKQASPKKNTLVLEKKI
EHTVFQVCGSGVDSVNKTISWLKELITKEQLSYTNDDECVSDFDMEEYEKLNEIQKELNI
TIEMNQKKTSIQVSGISRDVIKARDEIEGMIKSIRLAKEKESQADYISTYVEWQYIDKNI
TQCFDKMTNMKLEVAWKAKKKDTVVQIHNQDFTVDLSTNTATAPQGQTFTVQRLVKAEAE
IPANWSDMKQDKLLLVNLQTSDPEYNMVASAFRQTCSNFFIEKIERIQNPALWRRYQAYK
KSMDEKNGNVRNEKHLFHGTEASSLPQLNSNGFNRSYAGKNATAYGKGTYFAVKASYSAC
DTYSRPDTNGRKYMYYVRVLTGNYTNGNASLIVPPSRDPQNAADLYDTVTDNDKNPSIFV
VFYDNQTYPEYLITFRQ
NT seq 5454 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtcgggttccttcccgctgctggtcgagggctcttggggccccgacccccca
aagaacttgatcaacaagttgcaagtgtacttccagagccggaagaaatccggaggaggg
gagtgcgaggtcgtcccggagccggggaacccagcacgcttccgggtgctcttctccccg
gaggatgttcggcagaacgttctggagagagggaatcatgagttagtgtggcaagaaaaa
ggaacattcaagttgactgtcctgatgcccacagaccctgaggaagcctcagcctctaag
aagtcaaggaaggagtctccagaagaggagtccaagacaaaagaagatgctgtgaaacaa
ggtgatttggatataacacattctcccagcagtggatcagaaaagacagaagatgtccca
aaagaatgtgaaaatatttcctccatggtggcatttgaaaacctgcctgagaaagtatcc
gagatggtgctgaccatcctggtggagaatataagcggcctccccagtgatgactttaag
gtggaagtgaaccgagattttgctgttgccgtggttacctttcagaagcctatagatatc
aaaaaatttattgttgactgtatcagccaccgctcaaatcaacaactccagcttgccccg
agacttctggaaacaacgaatgtagtcagggtggaaaacctgcctcctggggtggacgag
taccagctgcaactcttcttcgaaaaccctttcaacgggggcggaagggtcgcccgagtt
gagtgtttcccagaagagagttcggcactggttgagttttgtgacagcaaagtgttagac
accgtcatggccaagacacacagttacaacaagatgccactgtctgtcttcccctattat
ccctctctgggcacagccttgtatggtgaggagaagcctctgataaagcttccagcatct
ttccaggagtctcttgatcttcctttgtggaagttctttcagaaaaataatcatctgatt
gaggagataaataatgaaatgaggtgctgtcactgtgagctgacttggtctgaaatcaat
ggtaaactgaccatcagacccgctgccaccttagtcaatcatagactgagcattaagacc
tggcagagagacgcatccgcagtgctctctggcatcaagtctaaatatggagtggagttg
tttgaagtgtgctcgccagtatgggacatcataaagcatgagttagagtcaggagatgac
agggttttggttgagtttgaaaaggagagtctaaacatagcaggaaaatcagaagacgtc
caaggcatgagccagaaaatcagggaattaatagagagcaccactgaaaagctcagaagg
gaagagcagagtctgaaggagaaagtggccatttccccgggaaagcattatcttttgcac
cacagtggcttcctgaaggatctaagcaaggggttcccagagatggagatctcttacgac
gccacggctcagttcctgtacttgaagggcttccgtgcagatgtgtacaaagtaaagtgt
gacatccaagagaaggtgttctccatggctcaaaaggatgtccaggtctcttctgaagtc
ttcgaatttctgcagcaagtagacagtcagagactctctaagtctctgtttgaggcacag
aacattctcgccatatatgagctgaaaggtacagctcttttcttagttggaagttctttc
aaagatctggcagaagccgagacaaaaatgctcagtgctttaagtcataagcagattgaa
gttgaggacaaggaggttctgataagtaatgggtggaagaagaaagttcaccctctgcaa
aagagacacagctcttgtgcaaccattatagtccagaatgaattgacttcagaaaccccg
gcaaaggtcattgttacaggctgtgtgaaagaagtgaatgaaatccataggcaacttttt
gagtatttggaaaacaacatgaaagttgaaagagcacttaaaatcaaaccatccttgatt
gttgactatttaaggacagacaagaggctattgtcaaagataaagaaggcacatgtgtat
gtgcattttaagcctaaagacaatccaaacagcattttgctaactggctgcaagagcaaa
gttctagagtgcatgaatctagtcaaggaaatccaggattcagtctgtgtccaaagattc
cagactgacaaagctggcgtcaggcacttcttcaaagataaagaatcgtattacaaaacg
gagattggtcgtcagttcggatgcgtcattgaattggaggaggatagagaggagaagggt
gaagaggaggatggtgaagaggaggagggtgaagaggagggagaaagcagcattaatgag
cagaagtgtcacctacagagggacatagcccccggagtcaaactgttcgtcctcgaggaa
gacctgagtcggtttcccgtcgatgtggtagtgaatgcagcaaatgagaacctgaagcat
atcagcggtctcgcacaggctctctcaaaggccgctggccctgaactccaaacagaatgt
gaccagatagtaaaagagggcggcgtggtcctacccggcaatgctgttatctcaaaagca
ggcaagctcccttgtcaccacgtcatccatgcggtagggcctcgatggaagggagataaa
gtcctggagtgtgtgagcctgctaaagaaagtggttagacaaagcctcagtttagctgag
gagcacaggtgccgctccatagccatgccagcggtcagcgctgggatctttgactttccc
ttagaactgtgtgtggcaaacattgtttcagccatcaaggaacacttccagcataagcga
gacacacacaccttgaaaaagatttacctggtgggcctacctgccaaggttgccagggcc
tttgctgaagctgtcaagactacatataaagactccctttcccacacagctttcccatcc
agtttaaaggctttagtaccacttgggaaaacgccccagaaacagggcagtctgctggtg
tcaccagaaggcctgagaatccgcctggtagaagaaggcgtgcagaatgctacgacccat
gccattgtgaactctatttccccggatcttaaactcaacaaaggacccctttctcaggcc
ttcttggaaaaggctgggccaaaactccaggaggaattgaccaggtcaggacaaggggtc
tctgttgatgtgggcacaattcttcaaaccagtggctgtaatctcaacagccgccacgtc
ttccatgtggtgcctccaccttggaaaagcaacaacagtgcatggtcactaaagatcatg
aaaaacatcatccgtgactgcctgaagaccaccgagaacctgtctctacaatcgattgca
tttccagcaataggaacgggaaatttgaggtttcctaaacctgaatttgctaaattaata
atttcagaagtgctcaaatttagtagcaggaaccaactgaaaactttacaagaggttcag
tttctgctgcacccgaaagaccatgaaaacattcaggcattttcagatgaatttgacaag
agaaataatggagatcctagtgacaaaaatcccaaggctgaagacacacaaggtatctat
gggagcctttccagccctactttaggaatgcatgaaatgaatattggtccaatcctcttc
caagtggccactgggaacatcatcaaagaagtggcagatgtgattgtcaattcaacaaca
ctcacatttgatctcaaatcaggggtctccaaagcaattttggaaggtgcaggacaaaat
gtggagcaagaatgttctctcttggctaaacagagtaaccatgggtatatagtcactgga
ggtggactattgcaatgtaagaacattattcatgttgttggtgggaatgatgtcaagaaa
tcggtttcctgtgttttggaagaatgtgaacaacggaattactcatccatttgcctacca
gctattggcacaggaaatgctcaacaggacccaaacgtagtagcaaaagcgataatagat
gccattgaagaatttgtccagaaaaaatcagtgcaggctgtgaagagagttaaagttgtt
atcttccagccccatattctgcaatttttttacgacaacatgaaagaaagagaaggctct
ccagctccccccaagcagtcgcctgccaagcagtcagtgatgtctaagattgcctccttt
cttggctttcccaagcaagcttcccccaaaaagaacaccctggttttggaaaagaaaata
gagcacacagttttccaggtatgtggttcaggggtagacagtgtgaacaaaacaatctcc
tggctaaaggaactgattaccaaagagcagctttcctacaccaatgacgatgagtgtgtc
agtgactttgacatggaggagtacgagaaactgaatgagattcagaaggaactgaacatc
accattgagatgaaccagaagaaaacttcgattcaagtttcaggaattagcagagacgtg
ataaaagctagagatgagattgagggcatgatcaagagcattcgattggctaaagaaaag
gaaagccaggcagactacatctctacatatgtggaatggcagtatattgataaaaacatc
acacagtgttttgacaaaatgaccaacatgaagttggaggttgcatggaaggccaagaag
aaggacacggttgtccaaattcacaatcaggatttcacggtggacttgagcacaaacaca
gccaccgctccccaaggccagactttcactgttcagcgcctcgtcaaagctgaagctgaa
atccctgccaattggagtgacatgaagcaggacaaattgcttctggtgaatctgcaaacc
agtgatcccgaatacaacatggtggcaagcgccttccgtcagacctgctcaaactttttc
atagagaagattgaaaggattcagaatccagctctttggagaaggtatcaggcatacaaa
aaaagtatggatgaaaagaatggcaatgtaagaaatgagaagcatctcttccatgggaca
gaggctagctctctaccacagctcaacagtaatggatttaaccgcagctatgctgggaag
aacgctactgcctacgggaaaggaacctattttgctgtcaaagcttcctattctgcctgt
gacacatattccagaccagacaccaatgggagaaagtatatgtattatgtgcgggttctc
actggaaactacacgaatggaaacgcgtcactgattgtgcccccctcgagggaccctcaa
aatgctgctgacttgtatgacaccgtcacagataatgataaaaatccaagtatatttgta
gtgttttatgacaaccaaacgtaccctgagtatcttatcacatttaggcagtaa

DBGET integrated database retrieval system