KEGG   Mus musculus (mouse): 554292
Entry
554292            CDS       T01002                                 

Gene name
Methig1, AB09951, Mettl7a2-Higd1c, Mettl7a2Higd1c, UbiE-YGH, UbiE-YGHL1
Definition
(RefSeq) methyltransferase hypoxia inducible domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Methyltransf_11 HIG_1_N Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran Methyltransf_8 MetW 2Fe-2S_thioredx Vpu
Other DBs
NCBI-GeneID: 554292
NCBI-ProteinID: NP_001019843
MGI: 3845761
Ensembl: ENSMUSG00000093789
Vega: OTTMUSG00000042221
UniProt: Q76I26
Position
15; 15 F1
AA seq 264 aa
MTLAVQAMRLVVCIVAFPMFLLNLLGMWSWVCKKCFPYFLKRFAMIYNWKMASLKRELFS
NLQEFAGPSGKLTLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLFKSVAENRQLQFE
RFVVAAGEDMHQVTDGSVDVVVCTLVLCSVKNQEKILREVCRVLKPREMSSDEWSAAEDE
GQLSRLLRKSRDSPFVPVGMAGFVAVLSYGLYKLNSRREQKMSLHLIHVRVAAQGCVVGA
VTLGVLYSMYKDYIRPRFFNVPKK
NT seq 795 nt   +upstreamnt  +downstreamnt
atgacgcttgccgtccaggccatgcggctggtggtctgcatcgtggcgtttcccatgttt
ctgctgaaccttctaggcatgtggagctgggtatgcaaaaagtgctttccctacttcctg
aagcggttcgccatgatatacaattggaagatggcgagcctaaagcgggagctcttcagc
aatctgcaggagttcgccggcccctcggggaagctaactctgctggaggtgggctgcggc
accggggccaacttcaagttctatccccccgggtgcagggtcacttgtatcgaccccaac
cccaactttgagaagttcttgttcaagagcgtcgcagagaaccggcagctgcagttcgag
cgcttcgtggtggcagccggggaggacatgcaccaggtgaccgatggctctgtggacgtg
gtggtctgcaccctggtgctgtgctcggtgaagaaccaggagaagattctgcgcgaggtg
tgccgagtgctgaagccgagagaaatgtcttcagatgagtggtcagcagctgaggatgaa
ggccagctgtcccgactcctccggaaatcgagagactccccctttgtccccgtgggcatg
gcaggctttgtggctgtgctgtcctacggtctttacaagctaaattccagaagagagcag
aagatgtcccttcatctcatccacgtgcgggttgccgcccaaggatgtgtggtgggagcc
gtgactctaggtgttctctactctatgtataaggactatatcagacctcggttcttcaat
gtacccaaaaagtaa

DBGET integrated database retrieval system