KEGG   Mus musculus (mouse): 55934Help
Entry
55934             CDS       T01002                                 

Gene name
Rp9, PAP-1, Rp9h
Definition
(RefSeq) retinitis pigmentosa 9 (human)
  KO
K19604  retinitis pigmentosa 9 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    55934 (Rp9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    55934 (Rp9)
Spliceosome [BR:mmu03041]
 Complex A
  U2 snRNP components
   U2 related factors
    55934 (Rp9)
 Complex B
    55934 (Rp9)
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    55934 (Rp9)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    55934 (Rp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SR-25 AP3D1 Med19 Ydc2-catalyt
Motif
Other DBs
NCBI-GeneID: 55934
NCBI-ProteinID: NP_061209
MGI: 2157166
Ensembl: ENSMUSG00000032239
Vega: OTTMUSG00000062377
UniProt: P97762 Q3TH81
Position
9; 9 A3
AA seq 213 aa AA seqDB search
MSSGAGSRRPREPPEHELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGFIKEDETKPE
DCIPDVPGNEHAREFLAHAPTKGLWMPLGREVKVMQCWRCKRYGHRTGDKECPFFIKGNQ
KLEQFRVAHEDPMYDIIRENKRHEKDVRIQQLKQLLEDSTSDDDGSSSSSSGDREKRKKR
KKKEKHKKRKKEKKKKKKRKHKASKSSESSDSE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccggggccgggtctcggcggccgcgggagccgccggagcacgagctgcagcgg
cggcgggagcagaaacggcggcggcacgacgcgcagcagctgcagcagctcaagcacctg
gagtccttttatgagaaacctcctcctgggtttataaaggaggacgagacgaagccagaa
gactgtataccagatgtgcccggcaatgaacatgccagggagtttctggctcacgctccg
actaaaggactgtggatgcccctggggagagaggtcaaagttatgcaatgttggcgttgc
aaacggtatggccatcgaacaggcgacaaagaatgccctttctttatcaaaggcaaccag
aagttagaacagttccgagtcgcacatgaagatcctatgtacgacatcattcgcgagaat
aaaagacatgaaaaggatgtaaggatccagcagttaaagcagttactggaggactccacc
tcagatgacgacgggagcagctccagctcctcgggggacagagagaagcgcaagaaaagg
aagaaaaaagaaaagcacaagaaacgcaagaaggagaagaaaaagaagaagaaacggaag
cacaaggcttccaagtccagtgagagctctgactcagagtga

DBGET integrated database retrieval system