KEGG   Mus musculus (mouse): 55938
Entry
55938             CDS       T01002                                 

Gene name
Apom, 1190010O19Rik, G3, G3a, NG2, NG20
Definition
(RefSeq) apolipoprotein M
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: ApoM Lipocalin
Other DBs
NCBI-GeneID: 55938
NCBI-ProteinID: NP_061286
MGI: 1930124
Ensembl: ENSMUSG00000024391
Vega: OTTMUSG00000037182
UniProt: Q9Z1R3
Structure
PDB: 
2XKL

Position
17; 17 B1
AA seq 190 aa
MFHQVWAALLSLYGLLFNSMNQCPEHSQLTALGMDDTETPEPHLGLWYFIAGAASTTEEL
ATFDPVDNIVFNMAAGSAPRQLQLRATIRTKSGVCVPRKWTYRLTEGKGNMELRTEGRPD
MKTDLFSSSCPGGIMLKETGQGYQRFLLYNRSPHPPEKCVEEFQSLTSCLDFKAFLVTPR
NQEACPLSSK
NT seq 573 nt   +upstreamnt  +downstreamnt
atgttccaccaagtttgggcagctctgctctctctctatggccttctctttaactccatg
aatcagtgccctgagcacagtcaactaactgcgctgggaatggacgacacagagacccca
gagccccacctgggcctgtggtactttattgcgggagcagcctccaccacggaagagttg
gcaacttttgatccggtggacaatattgtcttcaacatggctgccggctctgccccaagg
cagctccagcttcgtgctaccatccgcacgaaaagtggggtctgtgtgccccggaagtgg
acataccgattgactgaagggaaaggaaacatggaactcagaactgaagggcgcccagac
atgaaaacagacctgttctccagctcgtgcccaggaggaatcatgctgaaagagacgggc
cagggctaccagcgctttctcctctacaatcggtcaccacaccctccagagaagtgtgtg
gaggaattccagtctctgacctcttgcttggacttcaaagccttcttagtgactcccagg
aatcaagaggcctgcccgctgtccagcaagtga

DBGET integrated database retrieval system