KEGG   Mus musculus (mouse): 55948
Entry
55948             CDS       T01002                                 

Gene name
Sfn, 14-3-3, E, Er, Mme1, Ywh, Ywhas
Definition
(RefSeq) stratifin
  KO
K06644  stratifin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    55948 (Sfn)
   04115 p53 signaling pathway
    55948 (Sfn)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    55948 (Sfn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    55948 (Sfn)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   55948 (Sfn)
  Exosomal proteins of colorectal cancer cells
   55948 (Sfn)
  Exosomal proteins of bladder cancer cells
   55948 (Sfn)
SSDB
Motif
Pfam: 14-3-3 SIKE
Other DBs
NCBI-GeneID: 55948
NCBI-ProteinID: NP_061224
MGI: 1891831
Ensembl: ENSMUSG00000047281
Vega: OTTMUSG00000011150
UniProt: O70456
Position
4 D2.3; 4 66.25 cM
AA seq 248 aa
MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGG
EAPEEPQS
NT seq 747 nt   +upstreamnt  +downstreamnt
atggagagagccagtctgatccagaaggccaagttggctgaacaggccgaacggtatgaa
gacatggcagctttcatgaagagcgccgtggaaaagggcgaggagctctcctgcgaggag
cgaaacctgctttccgtagcttacaagaacgtggtgggcggccagagagcggcctggagg
gtcctgtccagcatcgagcagaagagcaacgaggaggggtcagaagagaagggccccgag
gtgaaagagtaccgggagaaggtagagaccgagctcagaggtgtgtgcgacaccgtactc
ggcctgctggactcgcacctcatcaaaggggctggagatgcagagagccgcgtcttctac
ctgaagatgaagggtgactactaccgctacctagccgaggtggccactggcgatgacaag
aagcgcatcatcgattctgcccggtcagcctaccaggaggccatggacatcagcaagaag
gagatgccgcctaccaaccccatccgcctgggcctggccctgaacttttcagtcttccac
tacgagatagccaacagccccgaggaggccatctcgctggccaagaccaccttcgacgag
gccatggccgacctgcacaccctcagtgaggactcctacaaggacagcaccctcatcatg
cagctcctgagagacaacctgacgctgtggacagccgacagtgctggggaagagggtggt
gaggctccggaggagccccagagctga

DBGET integrated database retrieval system