KEGG   Mus musculus (mouse): 55949
Entry
55949             CDS       T01002                                 

Gene name
Eef1b2, 2810017J07Rik, Eef1b
Definition
(RefSeq) eukaryotic translation elongation factor 1 beta 2
  KO
K03232  elongation factor 1-beta
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    55949 (Eef1b2)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Elongation factors
   55949 (Eef1b2)
SSDB
Motif
Pfam: EF1_GNE EF-1_beta_acid GST_C_3 GST_C_6 GST_C_2
Other DBs
NCBI-GeneID: 55949
NCBI-ProteinID: NP_061266
MGI: 1929520
Ensembl: ENSMUSG00000025967
Vega: OTTMUSG00000002614
UniProt: O70251
Position
1; 1 C2
AA seq 225 aa
MGFGDLKTPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSGPPPADLCHALRWYNHIK
SYEKEKASLPGVKKSLGKYGPSSVEDTTGSGAADAKDDDDIDLFGSDDEEESEEAKKLRE
ERLAQYESKKAKKPAVVAKSSILLDVKPWDDETDMTKLEECVRSIQADGLVWGSSKLVPV
GYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
NT seq 678 nt   +upstreamnt  +downstreamnt
atgggattcggagacctgaaaacccctgccggcctccaggtgctcaacgattacctggcg
gacaagagctacattgaggggtacgtgccatcacaagcagacgtggcagtatttgaagca
gtttctggtccaccacctgctgacctgtgtcatgccctacgttggtataatcacatcaag
tcgtatgaaaaagaaaaggccagcctgccgggagtgaagaaatctttgggcaagtatggc
cctagcagtgtagaagacaccacaggaagtggagctgcagatgctaaggatgatgacgac
attgatctctttggatctgatgatgaggaggaaagtgaggaagcaaagaagctacgagaa
gaacgccttgcacagtatgagtccaagaaagctaaaaagcctgcagttgttgcgaagtct
tccatcctactagacgtgaagccttgggatgatgagacggacatgacaaaactagaggag
tgtgtccgaagcattcaagcagatggcctggtgtggggctcctctaaattggttccagtg
ggatatggaattaaaaagcttcaaatacagtgtgtagttgaagatgataaggttggaacg
gatatgctggaagagcaaattactgcttttgaggactacgtacagtccatggatgtggct
gcttttaacaagatttaa

DBGET integrated database retrieval system