KEGG   Mus musculus (mouse): 55951Help
Entry
55951             CDS       T01002                                 

Gene name
Mpc1, 0610006G08Rik, 3830411I18Rik, Brp44l
Definition
(RefSeq) mitochondrial pyruvate carrier 1
  KO
K22138  mitochondrial pyruvate carrier 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    55951 (Mpc1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    55951 (Mpc1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    55951 (Mpc1)
Transporters [BR:mmu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   55951 (Mpc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MPC
Motif
Other DBs
NCBI-GeneID: 55951
NCBI-ProteinID: NP_061289
MGI: 1915240
Ensembl: ENSMUSG00000023861
Vega: OTTMUSG00000032995
UniProt: P63030 Q3UX28
Position
17 A1; 17 4.92 cM
AA seq 109 aa AA seqDB search
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALC
CYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggctggagcgctggtgcgcaaagcggcggactatgtccggagcaaggacttccgggac
tatctcatgagtacgcacttctggggcccagttgccaactggggtctccccattgctgct
atcaatgacatgaagaaatctccagagattatcagtgggcggatgactttcgccctctgt
tgctattctctgacattcatgagatttgcctacaaggtacaacctcgaaactggcttttg
tttgcatgccatgtaacaaacgaagtagctcagctcattcagggaggacgacttatcaac
tacgagatgagtaagcggccatctgcatag

DBGET integrated database retrieval system