KEGG   Mus musculus (mouse): 55978
Entry
55978             CDS       T01002                                 

Gene name
Ift20, 0610009H04Rik, AU015496, mIFT20
Definition
(RefSeq) intraflagellar transport 20
  KO
K16473  intraflagellar transport protein 20
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    55978 (Ift20)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    55978 (Ift20)
   Intraflagellar transport (IFT) complex B
    55978 (Ift20)
SSDB
Motif
Pfam: IFT20 4HB_MCP_1 Nnf1 HRDC YabA
Other DBs
NCBI-GeneID: 55978
NCBI-ProteinID: NP_061342
MGI: 1915585
Ensembl: ENSMUSG00000001105
Vega: OTTMUSG00000000139
UniProt: Q61025
Position
11; 11 B5
AA seq 132 aa
MAKDILGEAGLHFDELNKLRVLDPEVTQQTVELKEECKDFVDKIGQFQKIVGGLIELVDQ
LAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKTQLERYRVEYEALCKVEAE
QNEFIDQFIFQK
NT seq 399 nt   +upstreamnt  +downstreamnt
atggccaaggacatcttgggcgaggcagggctgcattttgatgaactgaacaagctccga
gtgttggacccagaggtcacccagcagactgtggagctcaaggaggagtgcaaggacttt
gtggacaaaattggccagtttcagaaaattgttggtggtctaattgagcttgttgatcag
cttgccaaagaagcagagaacgagaagatgaaggccattggtgctcggaacttgctgaag
tccatagcgaagcagagagaagcccagcagcagcagctgcaggccctgatagcagaaaag
aagacgcagctagaaaggtatcgggttgaatatgaagctttgtgtaaagtagaagcagaa
caaaatgaatttattgaccaatttatttttcagaaatga

DBGET integrated database retrieval system