KEGG   Mus musculus (house mouse): 55981
Entry
55981             CDS       T01002                                 
Symbol
Pigb, Pig-b
Name
(RefSeq) phosphatidylinositol glycan anchor biosynthesis, class B
  KO
K05286  GPI mannosyltransferase 3 [EC:2.4.1.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    55981 (Pigb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    55981 (Pigb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     55981 (Pigb)
Glycosyltransferases [BR:mmu01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   55981 (Pigb)
SSDB
Motif
Pfam: Glyco_transf_22 PMT_2
Other DBs
NCBI-GeneID: 55981
NCBI-ProteinID: NP_061377
MGI: 1891825
Ensembl: ENSMUSG00000079469
UniProt: Q9JJQ0
Position
9:complement(72920989..72946981)
AA seq 542 aa
MESQAADYNPASRNLHGSSGEMKLRRRKSRQYVSAQEKRSPRRGLLGENTYLVLFTIALR
ILNCFLVQTSFVPDEYWQSLEVAHRMVFSYGYLTWEWTERLRGYTYPLIFASIYKVLHLL
GKDSVQFLIWIPRLGQALLSAVADIRLYSLLKQLENQEVAQWVFLCQLCSWFTWYCCTRT
LTNTMETSLTALALFYYPLEGSRSVNSVKYSLLVALACVVRPTALIPWVPLLFRHFYQEQ
RKLHLTLHHFLPVGFITFSLSLIIDRIFFGQWTLVQLNFLKFNVLQNLGTFYGSHPWHWY
LSQGFPVVLGTHLPFFIHGCFLAPRRLHILLLTVLWTLLVYSMLGHKEFRFIYPVLPFCM
VFCGYSLAHLKTWRKAALSFLLLSNVPLAFYTGLVHQRGTLDVMNHIQKVCPRGPDPASA
SVFIMMPCHSTPYYSHVHCPLSMRFLQCPPDLTGKTQYLDEADMFYLNPLRWLQQEFHSN
ASLPTHLVTFNVLEKEINTFLTSGNYERAATFFHTHWPERRTGSHIHVYERRLPGRVNTG
GN
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggagtcccaggccgccgactataacccggcctcccgcaatctccacggcagctcggga
gaaatgaagctgcggaggaggaagtccaggcagtacgtgagcgcgcaggagaaacgctct
ccgcgccgtggtcttcttggagaaaacacttacctggtcttgtttaccatcgctctgcga
atacttaactgcttcttagtgcagacaagctttgttcctgatgaatactggcagtccctc
gaagttgcacaccgcatggttttcagttatggttatttgacctgggaatggacggagcga
ttgagaggctacacttaccccctcatcttcgccagtatttacaaggttctgcatcttctg
gggaaagacagtgttcaattcctgatctggattcccagacttggccaagctcttctgtct
gctgtagcggatataaggctctactccctcctgaagcagctggaaaaccaggaagtggca
caatgggtgttcctctgccagctgtgctcctggttcacatggtactgctgcacacggacc
ctcacgaacaccatggagacctccctcactgccctcgcccttttctactatcctctggaa
ggctcgaggtccgtgaacagcgtcaagtactcgctcctggtggcacttgcttgtgtggtc
cgccccacagctcttatcccatgggtgccgctgctcttcagacatttctaccaagaacag
agaaagctccatctgactctgcatcattttttacctgtaggatttataaccttcagtttg
tctctgataattgaccgtatcttttttggccaatggacgctggtccaattaaatttcttg
aaatttaacgtgctgcagaacctagggacgttttatggctcccatccatggcactggtac
ctcagtcaagggttcccagttgtcctggggacccacttacctttcttcattcacggttgc
ttcctagccccaaggaggctccacatactgctgctgaccgtgctgtggacactgctggta
tacagcatgttgggccacaaagaattcaggtttatctatccagttttaccattctgcatg
gtgttctgtggttactcactagcccacctgaagacatggaggaaggcagccctgagcttc
ctgctcttgtcaaatgtgccactggcattctacactggcctagttcatcagagaggcacc
ctggatgtcatgaatcacattcagaaagtctgcccccgaggtcctgacccagcttcggcc
tcagtattcataatgatgccctgccactccacgccttactacagccatgttcactgccca
ctgtccatgcggtttctccagtgtcccccagacttgactggaaaaactcagtatcttgat
gaagcagatatgttctacttaaaccccttaagatggttacaacaagaatttcacagcaat
gcgtcactccccactcacttggtcaccttcaatgttctggagaaggagatcaataccttc
ctcacctcagggaactacgagagggccgctacattcttccacactcactggccagagcgc
cgaactggaagtcacatacacgtctacgagcgaaggttacccggcagggtcaacacagga
gggaactga

DBGET integrated database retrieval system