KEGG   Mus musculus (mouse): 55982Help
Entry
55982             CDS       T01002                                 

Gene name
Paxip1, D5Ertd149e, PTIP
Definition
(RefSeq) PAX interacting (with transcription-activation domain) protein 1
  KO
K14972  PAX-interacting protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    55982 (Paxip1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMT complexes
    MLL3/MLL4 complex
     55982 (Paxip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTCB-BRCT BRCT BRCT_2 RTT107_BRCT_5 LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 55982
NCBI-ProteinID: NP_061366
MGI: 1890430
Ensembl: ENSMUSG00000002221
Vega: OTTMUSG00000054125
UniProt: Q6NZQ4
Position
5 B1; 5 13.23 cM
AA seq 1056 aa AA seqDB search
MSEPAPEVPEELFREVKYYAVGDIDPQVIQLLKAGKAKEVSYNALASHIISEDGDNPEVG
EAREVFDLPVVKPSWVTLSVQCGALLPVNGFSPESCQIFFGLTACLSQVSSEDRSALWAL
VTFHGGSCQLNLNKKCTHLIVPEPKGEKYERAVKRTSIKIVTPDWVLDCVSEKRRKDEAF
YHPRLIIYEEEEEEEEEGDNEEQDSQNEGSTEKSSVASSAVASPAEQPCSPKPRAEVSKG
ELMFDDSSDSSPEKQERSLNWAPAEAPPLNTAQRRLPQGKGPGLINLCANVPPVPGDILP
PDMRGNLMAPGQNLQNSERSEILGTWSPAVRTLRNITNNADIQQINRPSNVAHILQSLSA
PTKSLEQQVARGQQGHPNASAVLFGQAKGAPETHVLQQHHPPQQPQQQHPALHLQPQIMQ
LQQQQQQQQQQQQQPQPYPQPPSHQFPQQVHQHQFSQQQLQFPQQPLHPQQQLHRPQQQL
QPFQQQHALQQQLHQLQQQQLQHHQLAQLQQQQQQQHNLLQQQQQQQQLQRLQQQQQMQN
QAAHLSQASQALQHQVLPQQPLQLSLQPPPQQQQQQQLFGHDPAVEIPEESFLLGCVFAI
ADYPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCASQVSSMYTQALRERKRCVT
AHWLNTVLKKKKLMPPHRALHFPVAFPPGGKPCSQHIISVTGFVDNDRDDLKLMAYLAGA
KYTGYLCRSNTVLICKEPSGLKYEKAKEWRIPCVNAQWLGDILLGNFEALRQVQYSRYTA
FNMPDPFVPTPHLVLGLLDAWRTPVKVTAELLMGVRLPPKLKPNEVANIQPSSKRARIED
LPPPTKKLTPELTPLVLFTGFEPVQVQQYIKKLYILGGEVAECTKKCTHLIASKVTRTVK
FLTAISVVKHIVTPDWLEECFKRQTFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLF
KTKYFYITPGICPSLATMKAIVECAGGKVLAKQPSFRKLMEHKQNKSLSEIILISCENDL
HLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagccggcgcccgaagttccagaggagctattccgcgaggtcaagtactacgcg
gtgggcgacatcgacccgcaggttattcagctccttaaagctgggaaagccaaggaagtc
tcctacaatgccctggcctcacacatcatttcagaggatggggacaacccagaggtggga
gaagcccgtgaggtctttgacttgcccgttgtaaagccttcctgggtgactctgtccgtg
caatgtggcgctctcctgccagtcaatggtttctctccagagtcctgtcagatttttttt
ggactcactgcctgcctttctcaggtgtcatctgaagacagaagtgccctgtgggccttg
gttacgttccacgggggcagttgccaactaaaccttaacaagaagtgcacacacttgatt
gtcccagagccaaagggggagaaatacgagcgtgctgtcaaaagaacaagtattaagatt
gtcaccccggactgggtcctggactgtgtgtctgagaagaggaggaaggatgaagcgttt
taccatccacgcctgatcatctatgaggaggaggaagaggaggaggaagagggagacaac
gaggagcaggactcccagaacgagggcagcactgagaagtccagtgtcgccagctctgca
gtggcctcccctgctgagcagccgtgctctcccaagcccagggctgaggtgtccaaagga
gagttgatgtttgatgactcttctgactcatcccctgaaaagcaggagcgcagcttgaac
tgggcccctgctgaagccccaccactcaacacagcccagcgcaggctgcctcagggaaaa
gggccaggactcattaacctgtgtgccaatgtcccacctgttccaggggacattctgcct
cctgacatgcggggtaacttgatggcccctggacaaaacctccagaattctgagcggtca
gaaatactagggacctggagcccagctgtccggacgttgcgaaacattacaaacaatgct
gatatccagcagatcaaccggccatccaatgttgcacatatcttacaatccctttcagca
cccacaaaaagcctagagcagcaggtggcccgtggccagcagggacaccccaatgccagt
gctgtgctgtttggccaggctaaaggtgctcccgagacacacgtgttgcagcagcaccac
cctccccagcagcctcagcagcagcacccagccctgcacctccagccccagatcatgcag
ctccagcagcagcagcagcagcagcaacagcagcagcagcagccccagccctacccccag
cctccatcacatcagttcccgcagcaagtccatcagcatcagttctctcagcagcagctc
cagtttccacagcaaccattacaccctcagcagcagttgcatcgtcctcaacagcagctg
cagccatttcagcagcagcatgccctgcagcagcagcttcatcagttgcagcagcagcag
ctccagcaccaccagttagcacagctccagcaacagcagcaacagcagcacaaccttctc
cagcagcagcaacaacagcagcagctccaacgcttgcagcagcagcagcagatgcagaat
caagcagcacacttgagccaagcgtcccaggcactacagcaccaggttctaccccagcag
cccctgcagctgtccctgcagcccccacctcagcaacagcagcagcagcagctttttgga
catgacccagcagtggagattccagaagaaagcttcttgctaggatgtgtgtttgcaatt
gcggactatcccgagcagatgtcggataagcagctgctggccacctggaaaaggataatc
caggcacatggtggcactgtggaccccactttcacaagccgatgtacacacctcctctgc
gcaagtcaagtcagtagtatgtacacacaggcactacgggagagaaagcggtgtgtcact
gcacactggctcaacacagtgctgaagaagaagaagctgatgccccctcatcgagccctg
catttcccggtggcgttcccacctgggggcaaaccctgttcacagcatattatctctgtg
actggatttgttgacaatgacagagatgacctgaagttaatggcatacctggcaggtgcc
aagtacacagggtacctgtgccgtagcaacacagtcctcatctgtaaagaaccaagcggc
ttgaagtatgaaaaggccaaagagtggaggatcccatgtgtgaatgcacagtggctgggg
gacattctgctggggaactttgaggccctgcggcaagtgcagtacagccggtacaccgcc
ttcaacatgccggaccccttcgttcccactccacacttggtcttgggtcttctagatgca
tggaggaccccagtgaaggtgactgcagagctgttgatgggtgtaagattacctcctaag
ctgaaaccaaatgaggtcgctaacatccagccttcttctaaaagagccagaattgaagac
ttgccacctcccactaagaagctgactccagagctgacgcctttagtgctcttcactggg
tttgagcctgttcaagttcagcagtacattaagaagctgtacattcttggtggggaagtt
gctgagtgcacgaagaagtgtacccacctcattgccagcaaggtgacacgcacagtgaaa
ttcttgacggccatctctgtagtaaagcacattgtgactccggactggctggaggagtgc
ttcaagcgccagacatttatcgatgagcagaactacatccttcgagatgctgaggcagaa
gtgctcttctctttcagtctggaagagtccttaaagcgagcccatgtctctcccctcttt
aagacaaagtatttctatatcacccctggcatctgcccaagccttgcaactatgaaggca
attgtagagtgtgcagggggaaaggtgctagccaagcagccgtccttccggaagctcatg
gagcacaagcagaataagagtctttcagagatcattttaatatcctgtgagaacgacctg
cacttatgtcgcgagtactttgccaggggaatagatgttcacaatgcggagtttgtcctg
actggagtactcacacagacactggactatgaatcatataaatttaactga

DBGET integrated database retrieval system