KEGG   Mus musculus (mouse): 55989Help
Entry
55989             CDS       T01002                                 

Gene name
Nop58, MSSP, Nol5, SIK, nop5
Definition
(RefSeq) NOP58 ribonucleoprotein
  KO
K14565  nucleolar protein 58
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    55989 (Nop58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    55989 (Nop58)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    55989 (Nop58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 55989
NCBI-ProteinID: NP_061356
MGI: 1933184
Ensembl: ENSMUSG00000026020
Vega: OTTMUSG00000047257
UniProt: Q6DFW4
Position
1; 1 C2
AA seq 536 aa AA seqDB search
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF
TALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIR
SQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYI
MRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASASLSEFLSEEVEAEVKAAAEI
SMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQSSPKHKGKISR
MLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRILEDRGIRKISGTGKALAKAEKYE
HKSEVKTYDPSGDSTLPTCSKKRKIEEVDKEDEITEKKAKKAKIKIKAEVEEEMEEEEAE
EEQVVEEEPTVKKKKKKDKKKHIKEEPLSEEEPCTSTAVPSPEKKKKKKKKKDAED
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgttggtcctgtttgaaacgtccgttggctacgccatctttaaggttctgaatgagaag
aaacttcaagaggttgatagtttgtggaaagaatttgaaactccagagaaagcaaataaa
atagtaaagctaaaacattttgagaaatttcaggatacagcagaagcattagcagcattc
acagctctgatggaaggcaaaatcaataaacagctgaagaaagttttgaagaaaatagta
aaagaagcccatgaacctctggctgtcgctgatgctaaactaggaggggtaataaaggaa
aaattgaatctcagctgtatccatagtcctgttgttaatgaacttatgagaggaatccga
tcacaaatggatggcttgattcctggggtagaaccacgtgagatggcagccatgtgtctt
ggattggcccacagcctgtctcgatacagattgaaattcagtgctgataaagtggacaca
atgattgttcaggcaatttccttattagatgacttggataaagaactaaacaactacatt
atgcggtgtagggaatggtatggctggcatttccctgagttagggaaaattatttcagat
aatctgacatactgcaagtgtttacagaaagttggggacaggaagaactatgcatctgcc
tctctctctgaattcctgtctgaggaagtagaagcagaagtgaaagcagctgcagagata
tctatgggaacagaggtttctgaagaagatatttgcaacattctacatctgtgtacgcag
gtaattgaaatttctgaatataggactcagctctatgaatatctgcaaaatcgaatgatg
gccattgcacctaacgttacagtcatggttggagaattagttggagcacggcttattgct
catgcaggttctcttttgaatttggccaagcatgcagcttctacagttcagattcttgga
gcagaaaaagcacttttcagggccctcaaatctagacgagacacacctaaatatggactt
atttatcatgcttctcttgtaggccagtcaagtcccaaacacaaaggaaagatttctcga
atgctggcagccaaaactgttctggctatcagatacgacgcttttggtgaagattccagt
tctgcaatgggaattgagaacagagccaaattagaggccaggttgaggattttggaggac
agagggataagaaaaataagtggaacaggaaaggcattagcaaaagcagaaaagtatgaa
cacaaaagtgaagtgaagacttacgatccctctggtgactccacacttccaacttgttct
aaaaaacgcaaaatagaagaggtagataaagaggatgaaattactgaaaagaaagcaaaa
aaagccaagattaaaattaaagctgaagtagaggaggagatggaggaggaggaggcggag
gaagaacaggtagtagaagaggagccgactgtaaagaagaaaaagaagaaggataaaaag
aaacacataaaggaagagccactttccgaggaggagccatgtaccagcacagcagttcct
agtccagagaaaaagaagaaaaagaaaaagaagaaagatgctgaagactaa

DBGET integrated database retrieval system