KEGG   Mus musculus (house mouse): 56014
Entry
56014             CDS       T01002                                 
Symbol
Or13e8, MOR262-10, Olfr70, mOR6
Name
(RefSeq) olfactory receptor family 13 subfamily E member 8
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    56014 (Or13e8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    56014 (Or13e8)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    56014 (Or13e8)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 56014
NCBI-ProteinID: NP_062358
MGI: 1860079
Ensembl: ENSMUSG00000050215
Position
4:complement(43695000..43700807)
AA seq 316 aa
MAGTNHTEVIEYVLLGLQDHHGLEIALFVLCLGIYCMTLLGNSFLVGLIVLDTHLHSPMY
FFISNLSLIDICGTSSFTPMMLLNFLDVQRTISFPSCALQMYLTLALGTTECLLLAVMAY
DRYVAICQPLRYPELVNGPLCIQMAGISWGTGFANSLLHSILVWHLPFCGHYIINHFFCE
ILAVLKLACGDISLNALILTVATAVLTMTPLLLICLSYIFILAAILRVPSAAGRSKAFST
CSAHLTVVVIFYGTITFMYLKPKDQDPSVGKIITLLYAIVAPSLNAFIYSLRNSEVKAAV
TALLWGGLLTRKMSHF
NT seq 951 nt   +upstreamnt  +downstreamnt
atggctgggacaaaccacacagaggtgatagagtatgtcctgctgggacttcaggaccac
cacggcctcgagatcgctctgtttgtgctctgtctgggtatctactgtatgactctgcta
gggaactccttccttgtggggctgattgtgttggacacccacctgcacagccccatgtac
ttcttcatcagcaacctctctctcatagacatctgcggtacctcttccttcacacctatg
atgcttctcaacttcctggatgtccaaaggaccatctccttccccagctgtgccctgcag
atgtacctgaccctggccctaggtacaacggagtgcctgcttctggctgtgatggcatac
gaccggtacgtggccatctgtcagcccctccgctacccggagctcgtgaatgggccgcta
tgcatccagatggcaggaataagctgggggactggctttgccaactcgctcctgcattcc
atcctggtctggcatctccccttctgtggtcattacatcatcaaccatttcttctgtgag
atcttggcagtgctgaaactggcctgtggggacatttccctcaacgcgctgatattaacg
gtggccacagctgtcctgacaatgaccccgctcctgctcatatgcctctcttacattttc
atcctggctgctatccttagggtgccctctgctgcaggccggagcaaggccttctccacc
tgctctgcccacctcacggtggtggtgattttctatggaaccatcaccttcatgtacctc
aagcccaaagaccaagaccccagcgtgggtaagattatcacgttgctctatgcgatcgtg
gcgccctcactgaatgccttcatctacagtctgaggaactcagaggtgaaagctgctgtc
acagccttgttatggggaggtctactcaccaggaaaatgtcccacttttaa

DBGET integrated database retrieval system