KEGG   Mus musculus (mouse): 56016Help
Entry
56016             CDS       T01002                                 

Gene name
Hebp2, SOUL
Definition
(RefSeq) heme binding protein 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: SOUL
Motif
Other DBs
NCBI-GeneID: 56016
NCBI-ProteinID: NP_062360
MGI: 1860084
Ensembl: ENSMUSG00000019853
Vega: OTTMUSG00000063643
UniProt: Q9WU63
Position
10; 10 A3
AA seq 205 aa AA seqDB search
MAEEPEPDLGVAEGSEDQALEMPSWKAPEDIDPQPGSYEIRHYGPAKWVSTCVESLDWDS
AIQTGFTKLNGYIQGKNEKEMKIKLTAPVTSYVEPGSSPFSESTITISLYIPSEQQPDPP
RPSESDVFIEDRAEMTVFVRSFDGFSSGQKNQEQLLTLANILREEGKVFNEKVFYTAGYS
SPFQLLDRNNEVWLIQKNEPSVENK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggagccggagccagacctcggggtggccgagggctcagaggatcaggccttg
gagatgccgagctggaaagctccggaggacatagacccccagccaggaagttatgagatc
cggcactacggaccggctaagtgggtcagcacttgcgtggagtccctggactgggattca
gccatccagactggtttcacaaaattgaatggctacattcaaggcaaaaatgagaaagag
atgaaaatcaagctgacagcccccgtgacaagctacgtggagcccggctcaagtcctttc
agtgagtctaccattacgatttccctgtacatcccctctgagcagcaacccgatccaccc
aggccttcagagtcagatgtcttcattgaagacagagctgaaatgacggtgttcgtgcgg
tcttttgatggattctccagtggccaaaagaatcaagaacaacttttgaccttagcaaac
attctgagggaagaagggaaagttttcaacgaaaaggtcttttacactgcaggctacagc
agtcctttccaattacttgatagaaataacgaagtgtggctgattcagaaaaatgagccc
tccgtcgagaacaaataa

DBGET integrated database retrieval system