KEGG   Mus musculus (mouse): 56030Help
Entry
56030             CDS       T01002                                 

Gene name
Tmem131, 2610524E03Rik, CC28, D1Bwg0491e, Neg, RW1, YR-23, mKIAA0257
Definition
(RefSeq) transmembrane protein 131
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM131_like ASH
Motif
Other DBs
NCBI-GeneID: 56030
NCBI-ProteinID: NP_061360
MGI: 1927110
Ensembl: ENSMUSG00000026116
Vega: OTTMUSG00000049482
UniProt: O70472 Q9CSR0
Position
1 B; 1 15.42 cM
AA seq 1877 aa AA seqDB search
MGKRAGGAAAAAAAASTSSAAGLEPAAGRGGGPRSAAAGLLGALHLVMTLVVAAARAEKE
AFIQSESIIEVLRFDDGGLLQTETTLGLGSYQQKSISLYRGNCRPIRFEPPMLDFHEQPV
GMPKMEKVYLHNPSSEETITLVSISATTSHFHASFFQNRKILPGGNTSFDVVFLARVVGN
VENTLFINTSNHGVFTYQVFGVGVPNPYRLRPFLGARVPVNSSFSPIINIHNPHSEPLQV
VEMYSSGGDLHLELPTGQQGGTRKLWEIPPYETKGVMRASFSSREADNHTAFIRIKTNAS
DSTEFIILPVEVEVTTAPGIYSSTEMLDFGTLRTQDLPKVLNLHLLNSGTKDVPITSVRP
TPQNDAITVHFKPVTLKASESKYTKVASISFDASRAKKPSQFSGKITVKAKEKSYSKLEI
PYQAEVLDGYLGFDHAATLFHIQDSPADPVERPIYLTNTFSFAILIHDVLLPEEARIMFQ
VHNFSQPVLILPNESGYIFTLFFMPSTSSMHIDNNILLVTNASKFHLPVRVYTGFLDYFV
LPPKIEERFIDFGVLSATEASSILFAIINSNPIELAIKSWHIIGDGLSIELVATERGNRS
TVIASLPELERSSLPDQSPVTLASGHFAVFRVKLTAKKLEGVHDGAIQITTDYEILTIPV
KAVIAVGSLTCFPKHMVLPPSFPGKIVHQSLNIMNSFSQKVKIQQIRSLSEDVRFYYKRL
RGNREDLEPGKKSKIANIYFDPGLQCGDHCYIGLPFLSKSEPKVQPGVAMQEDLWDADWD
AHQSLFKAWMGIKENAGHRLNAMFEVNTDLQKNIVSKVSAELSWPSVLSSPRLLKFPLTN
TNCSSEEEISLENPADVPVYVQFIPLALYSNPSVFADKLVSRFNLSKVAKLDLRTLEFQV
YRNSAHPLQSPTGFTEGLSRHFILNLILKPGEKKSVKVKFTPLHNRTVSSLIIVRNNLTV
MDAVMVQGQGTTENLRVAGKLPGPGSSLRFKITEALLKDCIDRLKLREPNFTLKRTFKVE
NTGQLEIRVETIEISGYACEGYGFKVVNCQEFALSANASRDIVILFTPDFTASRVIRELK
FVTSSGSEFVFVLNASLPYHMLAACAEALPRPNWELALYIIISGVMSALFLLVIGTAYLE
AQGIWEPFRRRLSFEASNPPFDVGRPFDLRRIVGISSEGNLNTLGCEHSHGRGFYSNASS
RPGTGSHRQCGTSVHPHSSHGSKNSADVDNVRTRNSSSMSSRTSPQAAASQSTSKTSPLV
SETAAATQGHTASRKSRGAKQGQHSSQHHSHSHSPLEQHSQPPPPVPQHQEPPPERLSPA
PLTHPSHPERASTTRHSSEDSDITSLIEAMDKDFDHHDSSPLDVFTEQPPSPMSKSKGKG
KSLQQRKAKPPKKQEEKEKRGKGKPQEDELKDALADDDSSSTTTETSNPDTEPLLREDTE
KHKGRPAVPEKQESELSQGKPKSKKLLNAKKEIPTDVKGSSFELPYTPSLENKQRRNLPT
KIPLPTTLASGSKSRNPPKTKGTNKLVENRPVALSKFLPSSQELGNTSSSEGEKDSPPPE
WDAVPVHKPSSSTDSLYKLSLQTLNADIFLKQRQTSPTPASPSLPTAPCPFTSRGSYSSV
VNSSGSDTKAKQTSSSKSKLTKAASLPGKNGNPTFAAVAAGYDKSPGGNGFAKISSNKSD
FSSSLGISHIPVDSDGSDSSGLWSPVSNPNSPDFTPLNSFSAFGNSFNLTGAVFSKLSRS
CSQSSQRSWNEFNSGPSYLWDSPATDPSPSWPASSSSPTHTATSILGNSSGLWSTTPFSS
SIWSSNINSNLPFSTPTNALSSISLMGTENSAAAHTPSASGPADDLGQTYNPWRIWSPTV
GRRSSDPWSNSHFPHEN
NT seq 5634 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcgggcgggaggagcagccgccgccgccgccgccgcctccacgtcctccgcg
gccgggctggagcccgcggctggccgaggcgggggtcctcggagcgcagccgcgggcctc
ctgggagcgctgcacctggtgatgaccctcgtggtggccgcggcgcgggccgagaaggaa
gcattcattcagtcggagagcataatagaagtcctgcgctttgacgacggagggctacta
cagactgagacaacacttggcctcggttcatatcaacagaaaagcatttctctgtaccgg
ggtaattgcaggcccatacgattcgaaccgcccatgctggatttccatgagcagccagtt
ggaatgccaaaaatggaaaaagtctacttacataaccctagttctgaagaaacgattact
ttagtatcaatatctgctaccacatcacatttccatgcatcgttttttcaaaataggaaa
attcttccaggaggaaacacatcatttgatgtagtttttcttgcaagagtagtaggaaat
gtagaaaatactttatttattaacacatctaaccatggggtgttcacttaccaggtattt
ggtgttggggttccaaatccgtatcgattaaggccatttcttggggccagagtccccgta
aacagcagcttttcacccataataaacatacacaatcctcacagtgagcctttacaggtc
gtagagatgtactcgagtggaggtgaccttcacctagagctcccaacaggtcagcaagga
ggcaccaggaagctgtgggaaatccctccttatgaaaccaagggagtgatgagagccagc
ttttcctccagagaagcagacaatcacacagccttcatccggataaagacgaatgcatca
gacagcaccgagttcatcattctcccggttgaggttgaagttacaacagctcctggaatc
tattcctcaactgaaatgttagattttggaacacttagaacacaagatctaccaaaggtt
ttaaatcttcatttactaaattcaggaacaaaggatgtaccaataacaagtgttcgacca
acaccacaaaatgacgctatcacggtacattttaaaccagttacgttaaaagcttctgaa
agtaaatataccaaggttgccagcattagttttgatgcttcgagagcaaaaaagccatct
caattttctgggaaaataactgttaaagcaaaggaaaagagttattctaaactcgaaatc
ccctaccaagcagaagttctagatggttatttggggtttgatcacgccgccacgctgttt
cacatccaggacagtcctgctgacccagtggagaggccgatctacctgacgaacactttc
agttttgcgatcctcattcatgatgtgctgttaccagaagaagccagaataatgtttcag
gtgcacaacttcagccagccggttctcattcttcctaatgagtcgggatacatttttacc
ctgttttttatgccatccacctcatccatgcacatagacaacaacattttacttgttacc
aatgcttctaagtttcatttacctgtgcgggtatacacaggctttttagattactttgta
ttgccccccaaaatagaagaacgcttcatagattttggagtactgagtgctacagaagca
agtagtattttatttgcaattataaacagcaatccaattgagctggcaataaaaagttgg
catatcataggagatggcttatcaatagaacttgtagctacagagagaggcaacagaagc
acggtgattgcaagccttccagaactggagcggtcctctttgcccgaccagtccccggta
acattagcttcaggacactttgcagtgttcagagtcaaacttactgccaagaagctagaa
ggggtccatgatggggccatacagatcacaaccgactacgagatcctgaccatccctgtg
aaagctgtgatcgccgtgggctcgctgacctgcttccccaagcacatggttcttccccct
tccttcccagggaaaatagttcatcagagcttaaatattatgaattccttctcacagaag
gtgaagatacagcaaataaggtctttgtcagaagacgtacgattctactacaaacgatta
cggggtaatagggaagacttggagccagggaagaagtctaagattgcaaacatttatttt
gaccctgggctgcagtgtggggatcactgctatatcggcttgcctttcctatccaaatct
gaacccaaagtacagcctggggtggccatgcaggaggacttgtgggatgccgactgggac
gcacatcagagcttgttcaaggcttggatggggataaaggaaaacgcaggacataggttg
aatgctatgtttgaagtaaatacagatcttcagaaaaatatcgtatcaaaagtcagtgcc
gagctctcctggccgtctgtccttagctcgccccggctcctgaagttcccactcactaac
acaaactgttcttcggaagaagagattagcttagaaaaccctgcagacgtccctgtctac
gtccagttcatcccactggctttgtattccaacccctccgtctttgcagataagttagtc
tcaaggtttaacttgagtaaggtggccaagctagatttgagaacacttgaattccaagtc
tacaggaacagcgctcatccactgcaaagtccaacaggatttacagagggtctctctcgg
catttcattttaaacctcattttaaaacctggagaaaagaaatctgtcaaagtaaagttc
actccactccacaacagaactgtgtcttccctgatcatagtcagaaacaacctgactgtg
atggacgctgtgatggttcaaggtcaagggacaacggagaacttgagggtggcaggcaag
cttccaggtccaggaagctccttacgcttcaaaatcacagaagcattgttaaaggattgc
atagaccgtttgaaactaagagaaccaaatttcacattgaaaagaacattcaaagtagag
aatacgggacaacttgaaatccgtgtagaaaccattgagatcagtggatatgcgtgtgag
ggatatggttttaaagtggttaactgtcaagagtttgccctgagtgccaacgcctccaga
gacatagtcatattgtttactccagatttcacagcctccagagtcattcgggagctgaag
tttgtgacaagcagtggctccgagtttgtgtttgtgttgaatgcctctcttccgtaccac
atgctagccgcctgtgcagaagccctccctagacccaactgggagctcgcgctctacatc
atcatctccggggtcatgagtgcactctttctcctggtcattggaacagcctacttggaa
gctcaagggatttgggagcccttccgaaggcgactctcctttgaagcctcaaacccgccc
tttgatgtaggaaggccatttgatctcaggagaatcgttggtatttcatctgaaggaaac
ttgaacacacttggctgcgaacacagtcatggtaggggtttctatagtaacgcatcatcc
cggcctggtacaggcagtcacaggcagtgtggcacatcagtccacccacacagcagccat
ggcagcaaaaactcagctgatgtggacaacgtcagaaccagaaacagttcaagtatgtca
agcaggacttctccacaagcagctgcctcacagtctacaagcaaaaccagccccctagtc
tcagagacagctgcagcaacccagggtcacacagcaagcaggaagtccagaggggcaaag
cagggccagcacagcagccagcaccacagccacagccacagcccactggagcagcactca
cagcctccaccaccagtgcctcagcaccaggagccaccacccgaaaggctgtctcctgcc
cccctcacacacccttcccaccccgagcgagccagcaccacacggcacagctcagaggac
tccgacatcaccagtctcatagaagccatggacaaagactttgaccaccacgactcctcc
cccctagacgtgtttacagagcagcctccgtcaccgatgtcaaaaagcaaagggaaagga
aagtctctccaacaacgtaaggccaagcctccgaagaagcaggaggagaaggagaagagg
gggaaggggaagccgcaggaggatgagctgaaggacgctctggccgacgacgacagctcc
tccaccaccacagagacctccaaccccgacacagagccactcctcagggaggatacagag
aagcacaaggggagaccagccgtgcctgaaaaacaggaaagtgaactgtctcaagggaag
cccaagagcaaaaagctcttaaacgctaagaaagaaatcccaacagatgtgaaaggcagt
tcctttgaactaccgtacactccctcactggaaaataaacagcgtagaaatctcccaacc
aagattcctcttccaactacactagcaagtggatccaaatcacgaaatcccccgaaaaca
aaaggtacaaataagttagtggaaaacaggccagttgccctctcaaagttcctccccagc
agtcaagaactaggtaataccagcagctcagagggtgaaaaggattctcctccaccagaa
tgggatgctgtgccagttcacaagcccagcagctctactgacagtctttataaactgtct
ctgcaaaccctcaatgcagacattttcttaaaacaacgccagacctcgccaacacctgcc
tctccttctctgcccaccgctccctgcccgttcacatctcgtggcagctacagcagcgtt
gtcaacagctccggcagtgacacaaaagccaagcagacgagcagcagcaagagcaagctg
acaaaggcggcctcgctccccggcaagaatggcaaccctaccttcgccgccgtcgctgca
ggctatgacaagagcccgggtgggaatggatttgctaaaatttcttcaaacaaatcagat
ttttccagcagccttggcatttcacacattcctgttgacagcgatggctctgacagctcg
ggtttgtggagtcctgtcagcaaccccaacagccctgacttcacccccctcaattcgttc
tcagcctttggaaattcttttaatctaacaggtgcagttttcagcaaactgtcgcgatcc
tgcagtcagtcgtcccagagaagttggaatgagttcaacagcggcccctcctacctttgg
gattctccagccacagaccccagcccttcctggccggccagttccagctccccaacccac
acagccacttccatccttggcaacagcagcggcttgtggtccaccactccattcagcagc
tccatctggtccagcaacatcaacagcaaccttcctttctccactccaacaaacgcgctg
tcgagcatcagcctcatgggcacggaaaactctgccgccgcccacaccccttccgcctct
ggcccagctgacgacttgggacagacctacaacccctggcggatctggagccccacagtc
ggaagaagaagctctgacccttggtctaattcgcacttccctcatgaaaattaa

DBGET integrated database retrieval system