KEGG   Mus musculus (house mouse): 56031
Entry
56031             CDS       T01002                                 
Symbol
Ppie, 2010010D16Rik, Cyp33
Name
(RefSeq) peptidylprolyl isomerase E (cyclophilin E)
  KO
K09564  peptidyl-prolyl isomerase E (cyclophilin E) [EC:5.2.1.8]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    56031 (Ppie)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    56031 (Ppie)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    56031 (Ppie)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     56031 (Ppie)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19-related factors
    56031 (Ppie)
 Complex C
    56031 (Ppie)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    56031 (Ppie)
SSDB
Motif
Pfam: Pro_isomerase RRM_1 RRM_5 RRM_occluded DUF4944 RRM_7
Other DBs
NCBI-GeneID: 56031
NCBI-ProteinID: NP_062362
MGI: 1917118
Ensembl: ENSMUSG00000028651
UniProt: Q9QZH3
Position
4:complement(123020907..123033783)
AA seq 301 aa
MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA
AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGPE
PPKAEAQEGEPTAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEK
GFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
PNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVMIADCGEY
M
NT seq 906 nt   +upstreamnt  +downstreamnt
atggccaccaccaagcgtgtgctgtacgtgggcgggctggcagaagaggtggacgacaag
gttcttcatgctgcatttatcccctttggagacatcacagatattcaaattcctctggac
tatgaaacagaaaaacaccgagggtttgcttttgttgagtttgagttggcagaggatgcg
gcagcagctatcgacaacatgaatgaatctgagctctttggacggacgattcgtgtcaat
ttggccaagccaatgagaattaaagagggctcttccaggccagtctggtcagatgatgac
tggttgaagaagttttctgggaagactcttgaggagaataaggaagaagaaggacccgag
cctcccaaagctgaagcccaggagggagagcccactgcaaaaaaagcccggtcaaatcct
caggtgtacatggacatcaagattgggaacaagccagcaggccgcattcagatgctccta
cggtctgatgtggtgcccatgaccgcagaaaacttccgctgcctgtgcacccatgaaaag
ggctttggcttcaagggaagcagcttccaccgcatcatcccccagttcatgtgtcagggt
ggtgatttcacaaaccacaatggcacagggggcaagtccatctatgggaagaagtttgat
gatgaaaacttcatccttaaacacacaggaccaggcctcctctccatggccaattctggc
ccgaacaccaacggctcccagttcttcctgacctgtgataagacagattggctggacggc
aagcatgtggtatttggggaggtcacggaaggcctggatgtcttgcggcagatcgaggct
cagggcagcaaggatgggaagccaaagcagaaggtgatgattgccgactgtggagagtac
atgtga

DBGET integrated database retrieval system