KEGG   Mus musculus (mouse): 56032
Entry
56032             CDS       T01002                                 

Symbol
Nprl2, 2810446G01Rik, G21, N, NPR2L, Tusc, Tusc4
Name
(RefSeq) NPR2 like, GATOR1 complex subunit
  KO
K20405  nitrogen permease regulator 2-like protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    56032 (Nprl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56032 (Nprl2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   GATOR1 complex
    56032 (Nprl2)
SSDB
Motif
Pfam: NPR2
Other DBs
NCBI-GeneID: 56032
NCBI-ProteinID: NP_061367
MGI: 1914482
Ensembl: ENSMUSG00000010057
Vega: OTTMUSG00000050748
UniProt: Q9WUE4
Position
9; 9 F1
AA seq 380 aa
MGSSCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAM
EKKLIGCPVCIEHKKYSRNALLFNLGFVCDAQAKTCALEPIVKKLAGYLTTLELESSFVS
NEESKQKLVPIMTILLEELNASGRCTLPIDESNTIHLKVIEQRPDPPVAQEYDVPVFTKD
KEDFFSSQWDLTTQQILPYIDGFRHVQKISAEADVELNLVRIAIQNLLYYGVVTLVSILQ
YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGR
HPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVSREERSHPARLYTGCHSYDEICCKTGM
SYHELDERLENDPNIIICWK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgggcagcagctgccgcatcgaatgtatattcttcagcgagttccacccaacgctggga
cccaaaattacctatcaggtccctgaggatttcatctcgcgagaactgtttgacacggtc
caggtgtacatcatcaccaagcccgagttacagaacaagctcatcactgtcacagccatg
gagaagaagctgattggctgccccgtgtgcattgaacacaagaagtacagccgcaatgct
ctcctcttcaacctgggctttgtgtgtgacgctcaggctaagacttgtgccctggaaccc
atcgttaaaaagctggccggctacttgaccacgctggagcttgagagcagctttgtatcc
aacgaggagagcaagcagaagctggtgcccatcatgaccatcctgctggaagagctgaat
gcctccggccgctgcactctgcccattgatgaatccaacaccatccacttgaaggtgatc
gagcagcggccagaccctcctgttgcgcaggagtatgatgtgcccgtctttacaaaggac
aaggaggatttcttcagctcacagtgggaccttaccacacagcagatcctgccctacatt
gacgggtttcgccatgtccagaagatctccgctgaggcagacgtggaactcaacctggtg
cgcatcgccattcagaacctgctgtactatggtgttgtgacactggtatccatcctccag
tactccaatgtgtattgcccaacaccaaaagtccaggatctggtggatgacaagtccctg
caggaggcatgtctgtcctacgtcaccaagcaaggacacaaaagggccagtctccgagat
gtgttccagctatactgcagcctgagccctggtaccactgtgcgagacctcattggccgc
cacccccagcagttacaacacgttgatgaaaggaagctgatccagtttgggctgatgaag
aaccttatccggagactacagaaatatccagtccgagtgtctcgggaggagcggagccac
cctgccaggctttacacgggctgtcacagctatgatgagatctgctgcaagacaggcatg
agctaccatgagctggacgagcgactagaaaatgaccccaacatcatcatctgctggaag
tga

DBGET integrated database retrieval system