KEGG   Mus musculus (mouse): 56043
Entry
56043             CDS       T01002                                 

Gene name
Akr1e1, 1810061I10Rik, Akr1e2
Definition
(RefSeq) aldo-keto reductase family 1, member E1
  KO
K13981  1,5-anhydro-D-fructose reductase [EC:1.1.1.263]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    56043 (Akr1e1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.263  1,5-anhydro-D-fructose reductase
     56043 (Akr1e1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 56043
NCBI-ProteinID: NP_061347
MGI: 1914758
Ensembl: ENSMUSG00000045410
Vega: OTTMUSG00000027700
UniProt: Q9DCT1
Position
13; 13 A1
AA seq 301 aa
MENIPTVGLGTWKASPGEVTDAVKLAINLGYRHFDCAYLYHNESEVGMGISEKIKEGVVK
REDLFVVSKLWCTCHKKSLVKTACTNTLEALNLDYLDLYLIHWPMGFKPGEKDIPLDRNG
KVIPSHTSFLDTWEAMEDLVFEGLVKNLGVSNFNHEQLERLLDKPGLRVRPITNQIECHP
YLNQKKLIDFCHKRNVSVTAYRPLGGSGGGFHLMDDTVIRKIAKKHGKSPAQILIRFQIQ
RNLIVIPKSVTPSRIRENIQVFDFELTEKDMEELLSLDKNLRLATFPTTENHQDYPFHIE
Y
NT seq 906 nt   +upstreamnt  +downstreamnt
atggaaaacatccctacagtgggcttgggcacctggaaggcctccccaggagaagtgact
gatgcagttaagttggctatcaacctgggctaccggcacttcgattgtgcttacttatac
cacaatgagagcgaggtgggaatgggaatcagtgagaagatcaaggagggcgtggtgaag
agagaggatctctttgtagtcagtaagctgtggtgtacctgccacaagaagtcattggtg
aaaacagcatgcaccaataccctggaagccctaaacttggattacctggacctctacctc
atacactggcccatgggtttcaagcctggggaaaaagatatccctttggatcgcaatggc
aaggtcatacccagtcacaccagctttcttgacacttgggaggccatggaggacctggtg
tttgagggtctggtgaagaaccttggggtgtccaactttaaccatgaacagcttgagagg
cttttggataagcctggtttgagggtcaggccgataactaaccagattgaatgtcaccca
tatcttaatcaaaagaagctgattgatttttgccataaaagaaatgtgtctgtgactgct
taccgtcccctcggtggctcaggaggtgggtttcacttgatggatgatactgtcattcga
aagattgcaaagaagcatgggaagtctcctgctcagattttgatccgatttcagatccaa
aggaacttaatagtgatccccaaatctgtcaccccaagtcggattagagagaatatccag
gtatttgattttgaattaactgaaaaagatatggaggaactcctcagcctagacaagaac
ctccgtttggccacattccccacaactgaaaatcaccaagactatcctttccacatagag
tattga

DBGET integrated database retrieval system