KEGG   Mus musculus (house mouse): 56057
Entry
56057             CDS       T01002                                 
Symbol
Btg4, C86116, PC3B
Name
(RefSeq) BTG anti-proliferation factor 4
  KO
K14443  protein Tob/BTG
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    56057 (Btg4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    56057 (Btg4)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     56057 (Btg4)
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     56057 (Btg4)
SSDB
Motif
Pfam: BTG
Other DBs
NCBI-GeneID: 56057
NCBI-ProteinID: NP_062366
MGI: 1860140
Ensembl: ENSMUSG00000032056
UniProt: O70552
Position
9:51013486..51031224
AA seq 250 aa
MRDEIATAVFFVTRLVKKHEKLSTQQIETFALKLMTILFEKYRGHWHPDCPSKGQAFRCI
RINNNENKDPVLERACAESNVNFFHLGLPKEMTIWVDPYEVCCRYGEKKHPFTIASFKGR
WENWELAQHVSCAVNRATGDCSSGTSSDEESCSREAQIIPKVNNPKSVYQVENFKQSLQP
WFCLPRRKHLADGRGFLPGAACHPVPKSSKWCRPASRRVDRYHWVNAQLFSGQTAPGEPG
EEALSSLKQK
NT seq 753 nt   +upstreamnt  +downstreamnt
atgagagacgaaattgcaacagcagttttttttgtcacaagattggtgaaaaagcatgag
aaactgagtactcaacagatagaaacctttgcactaaagctgatgaccatcttgtttgaa
aagtacagaggtcactggcaccctgactgcccttccaaggggcaggcttttaggtgtatc
aggataaacaacaatgagaataaagaccctgttttagaaagggcttgtgctgagagtaat
gtgaatttttttcatctgggacttccaaaggagatgaccatatgggtcgatccctatgag
gtgtgctgtaggtatggtgagaaaaagcatccctttacaattgcttcttttaaaggtaga
tgggagaactgggagttggctcagcatgtcagctgtgcagttaacagagccacgggagac
tgctcctctggcacatcttctgatgaagaaagctgcagcagggaggcccagatcatcccc
aaagtgaacaacccaaagagcgtctaccaggttgaaaatttcaaacagtcattgcagccg
tggttctgcctcccccgtagaaagcatttggcagatggtcgtgggttcctcccgggggct
gcttgccacccagtgcccaagagctctaagtggtgccggccagcttcgcgcagggtggac
agatatcactgggtcaacgcacaactgttcagtggtcagacagcaccaggagagcctgga
gaagaggccttgtcttccctaaagcaaaaatga

DBGET integrated database retrieval system