KEGG   Mus musculus (mouse): 56066
Entry
56066             CDS       T01002                                 

Gene name
Cxcl11, Cxc11, H174, I, I-T, I-tac, IT, Ip9, Itac, SCYB9, Scyb1, Scyb11, Scyb9b, b-R, b-R1, betaR1
Definition
(RefSeq) chemokine (C-X-C motif) ligand 11
  KO
K12672  C-X-C motif chemokine 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    56066 (Cxcl11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    56066 (Cxcl11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    56066 (Cxcl11)
   04062 Chemokine signaling pathway
    56066 (Cxcl11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    56066 (Cxcl11)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   56066 (Cxcl11)
SSDB
Motif
Pfam: IL8 DUF4148
Other DBs
NCBI-GeneID: 56066
NCBI-ProteinID: NP_062367
MGI: 1860203
Ensembl: ENSMUSG00000060183
UniProt: Q9JHH5
Position
5; 5 E2
AA seq 100 aa
MNRKVTAIALAAIIWATAAQGFLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKV
EVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
NT seq 303 nt   +upstreamnt  +downstreamnt
atgaacaggaaggtcacagccatagccctggctgcgatcatctgggccacagctgctcaa
ggcttccttatgttcaaacaggggcgctgtctttgcatcggccccgggatgaaagccgtc
aaaatggcagagatcgagaaagcttctgtaatttacccgagtaacggctgcgacaaagtt
gaagtgattgttactatgaaggctcataaacgacaaaggtgcctggaccccagatccaag
caagctcgcctcataatgcaggcaatagaaaaaaagaattttttaaggcgtcaaaacatg
tga

DBGET integrated database retrieval system