KEGG   Mus musculus (mouse): 56078Help
Entry
56078             CDS       T01002                                 

Gene name
Car5b, 7330410H16Rik, CAVB, Ca5b, CarVb, D730005F19Rik
Definition
(RefSeq) carbonic anhydrase 5b, mitochondrial
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00910  Nitrogen metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    56078 (Car5b)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     56078 (Car5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase Tudor_3
Motif
Other DBs
NCBI-GeneID: 56078
NCBI-ProteinID: NP_851832
MGI: 1926249
Ensembl: ENSMUSG00000031373
Vega: OTTMUSG00000019511
UniProt: Q9QZA0
Position
X; X F5
AA seq 317 aa AA seqDB search
MAVMNHLRVILQVSSSTLPWRRCWVPRLVPRRSCSLYTCTYRTRNRALPPLWENLDLVPA
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHIWNNGYSFLVEFEDSTDKSVVEGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFESFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDTLVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDRDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNIQVKPKPTASEVTP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgatgaatcacctgagagtgattctacaagtctcttcgagtacattgccatgg
agaaggtgctgggttccgaggttggtgccacggaggtcctgcagtctctatacctgcaca
tacagaaccaggaaccgagccttacctccactctgggagaacttggaccttgttcctgcg
ggtgatcgacaatcacccatcaacatccgatggagggacagtgtttatgaccctggctta
aaaccactcaccatttcttatgacccagccacctgcctccacatctggaacaatgggtac
tcttttcttgtggaatttgaagattctacagataaatcagtggtcgagggggggcccctg
gaacacaactaccgactgaagcagtttcattttcattggggagccattgatgcttggggc
tctgagcacaccgtggacagtaaatgctacccagcagagctgcacttggtacattggaac
gcagtcaaatttgaaagttttgaggatgcagcactggaagaaaatggcttggctgtgata
ggtgtatttttaaagcttggtaaacatcataaagaactacagaaattggtggacactttg
ccatcaattaagcacaaggacaccctggtggaatttggatcatttgacccttcttgtctg
atgcctacttgcccagattactggacctactctgggtctctcactacgccgcccctctca
gagtctgtcacctggatcattaagaagcagccagttgaggttgaccgtgaccagcttgag
cagtttcggaccctgcttttcacttctgagggagagaaagagaaaagaatggtggacaac
ttccgccctcttcagccgctgatgaatcgcacagtccgctcatccttccgccatgactat
gtgctcaatatacaagtgaagcccaagccaacagccagcgaagtcaccccctaa

DBGET integrated database retrieval system