KEGG   Mus musculus (mouse): 56079
Entry
56079             CDS       T01002                                 

Gene name
Astn2, 1d8, A, Astnl, bM452J22.1
Definition
(RefSeq) astrotactin 2
  KO
K24479  astrotactin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    56079 (Astn2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   56079 (Astn2)
SSDB
Motif
Pfam: Annexin_like ASTN_2_hairpin FXa_inhibition MACPF cEGF Herpes_gE
Other DBs
NCBI-GeneID: 56079
NCBI-ProteinID: NP_996992
MGI: 1889277
Ensembl: ENSMUSG00000028373
Vega: OTTMUSG00000000315
UniProt: Q80Z10
Position
4; 4 C1
AA seq 1352 aa
MAAAGARRSPGRGLGLRGRPRLGFHPGPPPPPPPPLLLLFLLLLPPPPLLAGATAAAASR
EPDSPCRLKTVTVSTLPALRESDIGWSGARTGAAAGAGAGTGAGAGAAAAAASAASPGSA
GSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLEN
GTLYFHVSMSSSGQLAQATAPTLQEPSEIVEEQMHILHISVMGGLIALLLLLLVFTVALY
AQRRWQKRRRIPQKSASTEATHEIHYIPSVLLGPQARESFRSSRLQTHNSVIGVPIRETP
ILDDYDYEEEEEPPRRANHVSREDEFGSQMTHALDSLGRPGEEKVEFEKKAAAEATQETV
ESLMQKFKESFRANTPVEIGQLQPASRSSTSAGKRKRRNKSRGGISFGRTKGTSGSEADD
ETQLTFYTEQYRSRRRSKGLLKSPVNKTALTLIAVSSCILAMVCGNQMSCPLTVKVTLHV
PEHFIADGSSFVVSEGSYLDISDWLNPAKLSLYYQINATSPWVRDLCGQRTTDACEQLCD
PDTGECSCHEGYAPDPVHRHLCVRSDWGQSEGPWPYTTLERGYDLVTGEQAPEKILRSTF
SLGQGLWLPVSKSFVVPPVELSINPLASCKTDVLVTEDPADVREEAMLSTYFETINDLLS
SFGPVRDCSRNNGGCTRNFKCVSDRQVDSSGCVCPEELKPMKDGSGCYDHSKGIDCSDGF
NGGCEQLCLQQTLPLPYDTTSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDS
KFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRG
VLSEPLPDLQLLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLSAGFTNVLKILTKE
SSRDELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTELGSKKELK
SMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEI
NRVVPLYTLIQDNGTKEAFKNALMSSYWCSGKGDVIDDWCRCDLSAFDASGLPNCSPLPQ
PVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEFLSFADD
LLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLR
TACPLVDDNKAEEIADKIYNLYNGYTSGKEQQTAYNTLMEVSASMLFRVQHHYNSHYEKF
GDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQSRVDTIPYLFCRSEEVRPAG
MVWYSILKDTKITCEEKMVSMARNTYGETKGR
NT seq 4059 nt   +upstreamnt  +downstreamnt
atggccgccgccggcgcccggcgcagcccgggccgcggcttggggcttcgggggcggccg
aggctcggcttccacccggggccgccgccgccaccgccgccgccgctgctgttgctgttt
ctgctcctgctgccgccgccgccgttgctggccggcgccacggccgccgccgcctcgcgg
gagcccgacagcccatgccggctcaagaccgtcaccgtatccacgctgcccgctctgcgg
gaaagcgacatcggctggagcggtgcccgcaccggggccgcggccggggctggggccggg
accggagccggggccggagctgctgctgctgccgcctccgccgcgtccccgggctccgcg
ggttcagccggcacagccgcggagtctcgtctccttctctttgtgcgtaatgagctcccc
gggcgcatcgcggtacaagatgacctggacaacactgagctgcccttcttcaccctggag
atgtctggcacagcagcggacatttctttggttcactggaggcagcagtggctggagaat
ggcacattgtacttccacgtttccatgagcagctctgggcaactggctcaggccactgct
cccacactccaggagccctcggagatcgttgaggaacagatgcatatcctccacatttct
gtgatgggtggactcattgcacttctcctcctgctgttggtgttcacagtggcactgtat
gcccagcgacgctggcagaagcgccggcgcatcccacagaagagcgcaagtacagaagct
actcatgagattcactacatcccatcagtgctgctgggtcctcaggccagggaaagcttc
cgatcctccagacttcagacacacaactcagtcattggtgtgcctatccgggaaaccccc
atcctggatgactatgactatgaagaggaggaggaaccacccaggcgagccaaccacgtc
tcccgtgaggatgagtttggtagccagatgacccatgccctggacagcttgggaaggcca
ggagaagagaaagtggaatttgagaagaaagcagcagctgaggcgacacaggaaacagtg
gagtccctgatgcagaagttcaaggagagtttccgtgctaacacaccagtggagatcggt
cagttgcagccagcctcgcgcagcagcacctctgcagggaagaggaagcggaggaacaaa
tctcgagggggaatcagctttgggagaaccaaggggacatcaggctcagaagcagatgac
gaaacacagctgaccttctacacagagcagtaccgcagtcgccgccgcagcaaaggttta
ctgaaaagccctgtgaataagacagccttaacactgattgctgtgagctcctgcatcttg
gccatggtgtgtggcaaccagatgtcctgtccacttactgtgaaggtgactttgcatgtg
cctgaacacttcattgcagatgggagcagctttgtggtgagtgaaggaagctacctggat
atctccgattggctaaaccctgccaagctgtctctgtattaccagatcaatgccacctcg
ccatgggtgagagacctctgtggacagaggacgacagatgcctgtgaacagctctgtgac
ccagatactggggagtgcagttgtcatgaaggttacgcccctgacccagtccacagacat
ctatgtgttcgcagtgactggggtcaaagtgaaggaccttggccttacacaacactggag
aggggctatgatctggtgacaggagagcaagcccctgaaaagattctcaggtctactttc
agcttgggccaaggcctctggcttccggtcagcaaaagctttgtggtgccaccggtggag
ctgtccatcaaccccctggccagctgcaagacggatgtgctcgtcacagaagaccctgcg
gatgtcagggaagaagcaatgttgtccacgtactttgaaaccatcaacgacctgctgtcc
tcctttggtccagtccgtgactgctcaaggaacaacgggggctgtacccgtaacttcaag
tgtgtgtctgaccgccaggtggactcctcgggatgtgtgtgtcctgaggaactgaagccc
atgaaggatggctctggctgctatgatcactccaagggcatcgactgctctgatggcttt
aatggagggtgtgagcagctttgcctacaacaaacactgcctttgccctatgataccacc
tccagcaccatcttcatgttctgcggctgtgtggaagagtacaagctggctcctgatggg
aaatcctgtctaatgctctcagatgtctgtgagggccccaagtgcctcaaacctgactcc
aaattcaatgacaccctctttggagagatgctacatggttacaacaaccggacacaacat
gtaaaccaaggccaagtcttccaaatgacattcagggagaataacttcatcaaggacttt
ccacagctggcagatgggctgttggtgatcccgctgccagtggaagagcaatgccggggg
gttctctctgagccccttccagaccttcagcttctcacaggagacatcaggtatgatgag
gccatggggtaccccatggtgcaacagtggcgtgtccggagcaatctctatcgtgtgaag
ctgagtactatcaccctctcagcaggcttcaccaatgtcctaaagatcctgaccaaagag
agcagtcgggatgagctgctgtccttcatccagcactatggctcccactacattgccgag
gctttatacggttctgagctcacctgcatcatccattttcccagcaagaaggtccagcag
cagctatggctccaatatcagaaagagaccacggagctgggcagcaagaaggagctcaag
tccatgcccttcatcacctacctctccggtctcctgacagcccagatgctatcagatgac
cagctcatctcaggtgtggagattcgatgtgaggagaagggccgctgtccatctacctgt
cacctttgccgccggccaggcaaagagcagctgagccccacaccagtgctgctggagata
aaccgtgtggttccactttataccctcatccaagacaatggcacaaaggaggccttcaag
aatgcactgatgagttcttactggtgttctggtaaaggagatgtgattgatgactggtgc
aggtgtgacctcagtgcctttgatgccagtgggcttccaaattgtagcccccttccacag
ccggtgttacgactttctccaacagtggagccttccagcactgtggtttccctggagtgg
gtagatgttcagccagccattggaaccaaagtctctgactatattctgcagcacaagaaa
gtggatgaatacacagacacggacctatacacaggagaattcctgagttttgccgatgac
ttactttctggcctgggtacatcttgtgtagcagctggtcgaagccatggagaggttcct
gaagtcagtatctactcggtgatcttcaagtgcctggagccagatggtctttacaagttc
actctgtatgctgtggatactcgagggaggcactcagagctcagcacagtgactctaagg
acagcttgtccactggtagatgacaacaaagcagaagagatagcggacaagatttacaat
ctatacaatggttacacaagtggcaaggagcagcagactgcttacaacacactgatggaa
gtctccgcctccatgctcttccgtgtccagcaccactacaactctcactatgaaaagttt
ggtgacttcgtctggaggagtgaggatgagctaggaccaaggaaggctcatctgattctg
cggcggctggagcgggtcagcagccactgttctagtctcttgagaagcgcctacatccag
agtcgtgtggacaccataccctatctcttctgccgcagtgaggaggtccggcctgcagga
atggtgtggtacagcatcctcaaagacaccaaaatcacatgtgaggagaagatggtgtct
atggcccgaaacacgtacggggaaaccaaaggccggtga

DBGET integrated database retrieval system