KEGG   Mus musculus (mouse): 56086
Entry
56086             CDS       T01002                                 

Gene name
Set, 2610030F17Rik, 5730420M11Rik, AA407739, I-2PP2A, StF-IT, StF-IT-1, TAF-I
Definition
(RefSeq) SET nuclear oncogene
  KO
K11290  template-activating factor I
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    56086 (Set)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    NAPs (Nucleosome assembly proteins)
     56086 (Set)
SSDB
Motif
Pfam: NAP Phage_Mu_Gam Mst1_SARAH ZapB
Other DBs
NCBI-GeneID: 56086
NCBI-ProteinID: NP_076360
MGI: 1860267
Ensembl: ENSMUSG00000054766
Vega: OTTMUSG00000016726
UniProt: Q9EQU5 Q3T9S3
Position
2; 2 B
AA seq 289 aa
MAPKRQSAILPQPKKPRPAAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQ
ASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLT
RVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTK
RSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDE
EGEAEDDDDDDEEEEGLEDIDEEGDEDEGEEDDDEDEGEEGEEDEGEDD
NT seq 870 nt   +upstreamnt  +downstreamnt
atggccccgaagcggcagtctgcgatcctgcctcagcccaagaaacccagaccggctgct
gccccgaagctggaggacaagtcggcctctcccggcctgccgaagggagaaaaagaacag
caagaagcaattgaacatattgatgaagtacaaaatgaaatagacagacttaatgaacaa
gccagtgaggaaattttgaaagtagaacaaaaatataacaaactccgccaaccatttttt
cagaagaggtcagaattgatcgccaaaatcccaaatttttgggtaacaacatttgtcaac
catccacaagtgtctgcactgcttggggaggaggacgaggaggctctgcattatttgacc
agagttgaagtgacagaatttgaagacattaaatcaggttacagaatagatttttatttt
gatgaaaatccttactttgaaaataaagttctctccaaagaatttcatctgaacgagagt
ggtgacccgtcttcaaagtccaccgaaatcaaatggaaatctggaaaggatttgacaaaa
cgctcaagtcaaacgcaaaataaggccagcaggaagaggcagcacgaagagccagagagc
ttctttacctggtttactgaccattctgacgcaggtgctgatgagttaggagaggtcatc
aaagatgacatctggccaaatcccttgcagtactacctggttcccgacatggatgatgaa
gaaggagaggcagaagatgatgatgacgacgacgaagaggaggaggggctggaagatatt
gatgaagaaggagatgaggatgaaggtgaagaagatgacgatgaggatgaaggggaggaa
ggagaggaggacgaaggcgaggatgattag

DBGET integrated database retrieval system