KEGG   Mus musculus (house mouse): 56089
Entry
56089             CDS       T01002                                 
Symbol
Ramp3, AI850306
Name
(RefSeq) receptor (calcitonin) activity modifying protein 3
  KO
K08449  receptor activity modifying protein 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    56089 (Ramp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    56089 (Ramp3)
G protein-coupled receptors [BR:mmu04030]
 Secretin receptor family
  Others
   Receptor activity modifying protein
    56089 (Ramp3)
SSDB
Motif
Pfam: RAMP G6B
Other DBs
NCBI-GeneID: 56089
NCBI-ProteinID: NP_062384
MGI: 1860292
Ensembl: ENSMUSG00000041046
UniProt: Q9WUP1
Position
11:6608507..6627478
AA seq 147 aa
MKTPAQRLHLLPLLLLLCGECAQVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSE
FIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEVLIP
LIAVPVVLTVAMAGLVVWRSKHTDRLL
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaagaccccagcacagcggctgcaccttcttccactgttgttgctgctttgtggtgag
tgtgcccaggtatgcggctgcaacgagacagggatgctggagaggctgcctcgctgtggg
aaagccttcgctgacatgatgcagaaggtggctgtctggaagtggtgcaacctgtcggag
ttcatcgtgtattatgaaagcttcactaactgcaccgagatggagaccaacatcatgggc
tgctactggcccaacccgctggcccagagcttcatcactggaatccacaggcagttcttt
tccaactgcacggtggacaggacccactgggaagaccccccggatgaagtactcatccca
ctgatcgcggttcctgtcgtgctgactgtggctatggctggcctggtggtgtggcgcagc
aagcacactgatcggctgctgtga

DBGET integrated database retrieval system