KEGG   Mus musculus (house mouse): 56096
Entry
56096             CDS       T01002                                 
Symbol
Plac1, DXWsu72e, Epcs26, Oosp2l
Name
(RefSeq) placental specific protein 1
  KO
K25718  placenta-specific protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    56096 (Plac1)
SSDB
Motif
Pfam: Zona_pellucida
Other DBs
NCBI-GeneID: 56096
NCBI-ProteinID: NP_062411
MGI: 1926287
Ensembl: ENSMUSG00000061082
UniProt: Q9JI83
Position
X:complement(52158870..52328969)
AA seq 173 aa
MNLRKFLGGTVLVAFMLFSYSEQNQVNVLCSTDWFMVTVHPFLLNNDVYVHFYEVHLGLG
CPPNHVHPHFYQFHYRVTECGIRIKAVSPDVVIYSSEIHYASKGSSTKYVIPVSCAAPRR
SPWLTKPYSAKAPSNNMGATPKNDTSYHVFTLPEPSEQPNCSCPPYVYNQKSM
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaaccttcgcaagttcctgggaggcactgtcttagtcgccttcatgctcttcagctac
tcggagcaaaaccaagtgaatgtgctgtgctcgacagattggttcatggtcaccgttcac
cccttcttgctgaataatgatgtgtatgttcatttttacgaggtgcacctgggccttggt
tgccctcccaatcatgttcacccacatttctaccagtttcactaccgcgttaccgaatgt
ggcatccgcatcaaggctgtctctccagatgtcgtcatctatagctctgagattcactat
gcttccaagggctcatcaacgaaatatgtgattcccgtgtcctgtgctgcccctcgccgg
tccccttggctcactaagccctactccgcgaaagcacctagcaacaacatgggtgcgact
ccgaagaatgatacttcctaccacgtgttcaccttgccagagcctagcgaacaacccaac
tgcagctgcccaccttatgtctacaatcaaaagagcatgtaa

DBGET integrated database retrieval system