KEGG   Mus musculus (mouse): 56177
Entry
56177             CDS       T01002                                 

Symbol
Olfm1, AMY, AW742568, Noe1, OlfA, Pancortin, Pancortin3
Name
(RefSeq) olfactomedin 1
  KO
K25444  noelin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    56177 (Olfm1)
SSDB
Motif
Pfam: Noelin-1 BLOC1_2 CENP-Q Enkurin CLZ Ephrin
Other DBs
NCBI-GeneID: 56177
NCBI-ProteinID: NP_001033701
MGI: 1860437
Ensembl: ENSMUSG00000026833
Vega: OTTMUSG00000011625
UniProt: O88998
Structure
Position
2:28083105..28120748
AA seq 153 aa
MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTGVLPTNPEESW
QVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQ
YVEKMENQMKGLETKFKQVEESHKQHLARQFKG
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtcggtgccgctgctgaagatcggggtcgtgctaagcaccatggccatgatcaccaac
tggatgtcccagacgctgccctcgctggtgggcctcaataccacccggctttcggccgcc
agcggcgggacgctggaccgcagcaccggcgtgttgcccaccaaccccgaggagagctgg
caggtgtacagctctgcccaggacagtgagggcaggtgtatctgcacagtggtcgccccc
cagcagaccatgtgttcgcgggatgcccgcacaaaacagctgaggcagctactggagaag
gtgcaaaacatgtctcaatccatagaagtcttggacaggcgaactcagagagacctgcag
tacgtggagaagatggagaaccagatgaaaggcctggagaccaagttcaagcaggtggag
gagagccataagcagcatctagccaggcagttcaagggctaa

DBGET integrated database retrieval system