KEGG   Mus musculus (mouse): 56183
Entry
56183             CDS       T01002                                 

Gene name
Nmu
Definition
(RefSeq) neuromedin U
  KO
K05249  neuromedin U
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    56183 (Nmu)
SSDB
Motif
Pfam: NMU
Other DBs
NCBI-GeneID: 56183
NCBI-ProteinID: NP_062388
MGI: 1860476
Ensembl: ENSMUSG00000029236
Vega: OTTMUSG00000026473
UniProt: Q9QXK8 Q059S5
Position
5; 5 C3.3
AA seq 174 aa
MSRAAGHRPGLSAGQLAAATASPLLSLLLLLACCADACKGVPISPQRLQPEQELQLWNEI
HEACASFLSIDSRPQASVALRELCRIVMEISQKPQEQSEKDNTKRFLFHYSKTQKLGNSN
VVSSVVHPLLQLVPQLHERRMKRFKAEYQSPSVGQSKGYFLFRPRNGKRSTSFI
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtcgcgagcagcgggtcaccgtccagggctgtccgcaggacaattggctgctgcaacc
gcatctcctctcctgtcactgctgctgctgctcgcctgctgtgcagacgcttgcaaaggt
gtgccaatatcacctcaaagattgcagccagaacaagaactacaattgtggaatgagatt
catgaagcttgtgcgtcctttctgtccattgattccaggcctcaggcatctgttgcactg
agggagctttgccgtatagtgatggagatttcccagaagcctcaggaacaaagtgagaaa
gataatactaagaggttcttatttcactattcaaagacacagaagttgggaaattcaaat
gttgtgtcctctgttgtgcatccgttgctgcagctcgtccctcaactgcatgagagaaga
atgaagagattcaaagcagaataccagagtccttccgtgggtcaaagtaagggatacttt
ttattcaggccacgcaacgggaagaggtcaacaagtttcatttaa

DBGET integrated database retrieval system