KEGG   Mus musculus (house mouse): 56198
Entry
56198             CDS       T01002                                 
Symbol
Heyl, Hey3, Hrt3, bHLHb33, hesr3
Name
(RefSeq) hairy/enhancer-of-split related with YRPW motif-like
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    56198 (Heyl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56198 (Heyl)
  09162 Cancer: specific types
   05224 Breast cancer
    56198 (Heyl)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    56198 (Heyl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    56198 (Heyl)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    56198 (Heyl)
SSDB
Motif
Pfam: HLH Hairy_orange
Other DBs
NCBI-GeneID: 56198
NCBI-ProteinID: NP_038933
MGI: 1860511
Ensembl: ENSMUSG00000032744
Position
4:123127349..123143663
AA seq 326 aa
MKRPRAPSGSDGESDGPIDVGQENDLSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHASGGTGFFDARALAVDFRSIG
FRECLTEVIRYLGVLEGPSSHADPVRIRLLSHLKSYAAEMEPSPTTTSALAFPVWPWSFL
HSCPGLPSLNSQLAILGRVPGPVLPSISSPPYPISALRSAPVHRPAGTIPPTRRNLLPSR
GVTSTQRAHLPERPAAPPPTALDARAARSIVPIPPCSPTTAPGAGKSDDNVSGSISSPCP
SGPTGRPAGAVFYHSWVSEITEIGAF
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaagcggcccagggcgcccagtggctccgacggcgagtctgatggacccatcgatgtg
ggtcaagagaacgatcttagccagatggccaggccgctgactacccccagcccttcgcag
atgcaagcccggaagaagcgcagagggatcatagagaaacggcgcagagaccgcatcaac
agtagcctttctgaattgcgacgattggtccccactgcctttgagaaacagggctcctcc
aagctggagaaagctgaggtcttgcagatgaccgtggatcacttgaagatgctccatgcc
tctggtggcacagggttctttgatgcccgagccctggctgttgacttccggagtattggg
tttcgggaatgcctcactgaggtcataagatacctgggggtcctggaaggacccagcagc
catgccgaccctgtccggattcgcctcctctcccacctcaagagctatgcagcagagatg
gagccctcacccacgaccaccagtgccctggcctttcccgtgtggccctggtccttcctg
catagctgtccaggcttgccttccctgaacagtcagctcgccatcctgggaagagtgccc
ggccctgtcctccccagcatctcttctcccccttaccctatctcagccctgaggtcggca
ccagtgcacagacctgctggtaccatccccccaacccggcggaatttgttgcccagccga
ggggtgacttccacccagagagcccatcttcctgagaggccagctgcccctccacccaca
gcccttgatgccagggctgccaggagcatagtcccaatcccaccatgttcccccacaaca
gcccctggagctgggaaatctgatgacaatgtgtctggttctatctccagtccatgtcct
tcagggccaactgggaggcctgcgggagcagtgttctaccactcttgggtctcagaaatc
actgaaattggggctttctga

DBGET integrated database retrieval system