KEGG   Mus musculus (mouse): 56200Help
Entry
56200             CDS       T01002                                 

Gene name
Ddx21, AI255159, AL022742, D10Ertd645e, D10Wsu42e
Definition
(RefSeq) DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
  KO
K16911  ATP-dependent RNA helicase DDX21 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    56200 (Ddx21)
   03036 Chromosome and associated proteins [BR:mmu03036]
    56200 (Ddx21)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     56200 (Ddx21)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    56200 (Ddx21)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    56200 (Ddx21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD GUCT Helicase_C ResIII CMS1 AAA_30 ERCC3_RAD25_C
Motif
Other DBs
NCBI-GeneID: 56200
NCBI-ProteinID: NP_062426
MGI: 1860494
Ensembl: ENSMUSG00000020075
UniProt: Q9JIK5 Q6PCP0
Position
10 B4; 10 32.43 cM
AA seq 851 aa AA seqDB search
MPGKLRSGAKLGSDGAEESMETLPKPSEKKTRKEKTKSKTEEATEGMEEAVSSKAKKTNK
KGPSEDDVDPPKSRKAKKQEEEPQDDTASTSKTSKKKKEPLEKQADSETKEIITEEPSEE
EADMPKPKKMKKGKEANGDAGEKSPKLKNGLSQPSEEEADIPKPKKMKKGKEANGDAGEK
SPKLKNGLSQPSEEEVDIPKPKKMKKGKEASGDAGEKSPRLKDGLSQPSEPKSNSSDAPG
EESSSETEKEIPVEQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIA
QARTGTGKTFSFAIPLIEKLQGGLQERKRGRAPQVLVLAPTRELANQVSKDFSDITKKLS
VACFYGGTPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMG
FADQVEEILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKAA
ITVEHLAIKCHWTERAAVIGDVIRVYSGHQGRTIIFCETKKDAQELSQNTCIKQDAQSLH
GDIPQKQREITLKGFRNGNFGVLVATNVAARGLDIPEVDLVVQSCPPKDVESYIHRSGRT
GRAGRTGVCICFYQNKEEYQLAQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPP
TAISHFKQSAEKLIEEKGAVEALAAALAHISGATSVDQRSLINSQAGFVTMILRCSIEMP
NISYAWKELKEQLGESIDAKVKGMVFLKGKLGVCFDVRTEAVTEIQEKWHDSRRWQLTVA
TEQPELEGPPDGYRGRMGQRDGSRGAFRGQRGGSRNFRGQGQRGGSRNFRGQRPGGGNRG
QKRSFSKAFGQ
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgccgggaaaactccgcagtggggccaagttgggctcagacggggccgaggagagcatg
gagacgctgccgaagccaagcgagaagaaaactagaaaagagaagacaaaatcaaagacc
gaagaagcaacagaaggaatggaagaggccgtttcctccaaagcaaagaaaacaaacaag
aaagggccttctgaggatgatgtggatccccctaaatccaggaaggccaagaagcaggag
gaggagcctcaagacgacactgcttctacaagcaaaacctccaagaagaaaaaggagccc
cttgagaagcaagcagactctgaaaccaaagagataataacagaggagccttccgaagaa
gaggcagacatgcctaagcccaagaagatgaagaaagggaaagaagcaaacggagatgcc
ggagagaaaagccccaagctgaagaatggactctcccaaccttccgaagaagaggcagac
attcctaagcccaagaagatgaagaaagggaaagaagcaaacggagatgctggagagaaa
agccccaagctgaagaatggactctcccaaccttccgaagaagaggtagacattcctaag
cccaagaagatgaagaaagggaaagaagcaagcggagatgcgggagagaaaagccccagg
ctgaaggatggactctcccaaccttctgaaccgaaatccaactccagtgatgctcctggt
gaggaaagtagtagcgagacagaaaaggaaatacctgtggagcagaaagagggagctttc
tctaattttcccatttctgaagagactgtcaagcttctcaaagctcgtggggtgaacttc
ctgtttcctatacaagccaagacctttcatcatgtgtacagtgggaaagacttaattgcc
caggcacggacaggaaccggaaagacattctcttttgccatccctttaattgagaaactt
caaggtgggctacaagagaggaagagaggccgagcccctcaggtgctagtccttgcaccc
acaagagaattagcaaatcaagtgagcaaagacttcagcgacatcaccaaaaagctctct
gtagcttgtttttatggtggaacaccctacggtggtcagattgaacgaatgcggagtggg
attgatatcctggttgggaccccaggtcgtattaaagaccacttgcagaatggcaagcta
gatctcaccaaacttaaacatgttgtcctggatgaagtcgaccagatgttggatatgggt
tttgctgatcaagtggaagaaattttatgtgttgcatacaagaaagattctgaagacaac
ccccaaacattgcttttctctgcaacttgccctcattgggtgtttaatgttgctaagaaa
tacatgaaatctacatacgaacaggtggacctgattggtaaaaagactcagaaagcagct
ataactgtggagcacctggcgattaagtgtcactggacagaaagggcagcggtgattggg
gatgtgatccgagtgtacagtggtcatcaagggcgcacgatcatcttctgtgaaaccaag
aaggatgcccaggagctatctcagaacacgtgcataaagcaggatgcccagtccttacat
ggcgacattccacagaagcaaagggaaatcaccctgaaaggtttccgaaatggcaatttt
ggagttttggtggcaaccaatgttgctgcccgtgggttagacatccctgaggttgacttg
gttgttcagagctgcccaccaaaggatgtggagtcttacattcatcgttcggggcggaca
ggcagagctggaaggacaggagtttgcatctgcttttaccagaacaaagaagagtaccag
ttagcacaagtggagcagaaagcgggaattaaatttaaacggataggtgttccttctgca
acggaaataataaaagcctccagcaaagacgccatcaggctcttggattctgtgcctccc
actgccattagccatttcaagcagtcagctgagaagctgattgaggagaagggagctgta
gaggccttggcagctgctctggcccacatctcaggagccacatcagtcgatcagcgctcc
ctgatcaactcgcaagcaggctttgtgaccatgatcctgcggtgctccattgagatgccc
aacatcagttacgcttggaaagaacttaaggagcagctgggcgagagcatcgatgccaaa
gtgaagggaatggtcttcctcaaaggaaaactgggggtttgttttgatgtccgaactgaa
gcagtcacagaaatacaggagaagtggcatgattcgagacgctggcagctcaccgtggcc
accgagcagccagagctggagggacctccagacggatatcgaggccgcatgggtcagcgt
gatggcagccgtggtgctttcagaggacagcggggtggaagcaggaacttccggggacag
ggacagcgaggaggaagtagaaacttccgaggacagcgaccaggaggtggcaacagaggc
cagaagcggagttttagtaaagcgtttggtcagtga

DBGET integrated database retrieval system